Recombinant Salmonella enteritidis PT4 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
rsxE; rnfE; SEN1593; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
Recombinant Salmonella enteritidis PT4 Electron transport complex protein RnfE (rnfE) is a component of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane. It plays a critical role in maintaining the reduced state of SoxR.
Database Links

KEGG: set:SEN1593

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the RnfE protein and how does it function within the Salmonella enteritidis PT4 electron transport complex?

The RnfE protein is a component of the electron transport complex in Salmonella enteritidis PT4, which functions in energy conservation through ion gradient formation. Similar to other electron transport complex proteins like RnfB, RnfE likely contains iron-sulfur clusters that participate in electron transfer reactions . Methodologically, researchers can investigate its function through gene deletion studies combined with growth assays under various respiratory conditions. Complementation experiments using recombinant RnfE can confirm phenotypes observed in deletion mutants. Additionally, membrane potential measurements using fluorescent probes can directly assess the protein's contribution to maintaining ion gradients across the bacterial membrane.

What expression systems are most effective for producing recombinant Salmonella enteritidis PT4 RnfE protein?

Based on established protocols for similar electron transport proteins like RnfB, E. coli expression systems are often most effective for producing recombinant Salmonella proteins . For optimal expression, researchers should:

  • Select an appropriate vector containing strong promoters (e.g., T7)

  • Optimize codon usage for the expression host

  • Consider fusion tags that enhance solubility and facilitate purification

  • Test various induction conditions (temperature, inducer concentration, duration)

The methodology should include small-scale expression trials before scaling up, with protein expression verification via SDS-PAGE and Western blotting. For membrane-associated proteins like RnfE, additional consideration must be given to membrane fraction isolation and solubilization using appropriate detergents.

How can researchers verify the structural integrity of purified recombinant RnfE protein?

To verify structural integrity, researchers should employ multiple complementary techniques:

TechniqueInformation ProvidedMethodological Considerations
Circular Dichroism (CD)Secondary structure contentRequires 0.1-1.0 mg/mL protein in buffer without interfering compounds
Thermal Shift AssayProtein stability and foldingCan be performed with small amounts (μg) of protein
Size Exclusion ChromatographyOligomeric state and aggregationShould be calibrated with appropriate molecular weight standards
Activity AssaysFunctional integritySpecific to electron transport function (e.g., reduction of artificial electron acceptors)

For RnfE specifically, researchers should verify iron-sulfur cluster incorporation through UV-visible spectroscopy, monitoring characteristic absorption peaks in the 300-500 nm range .

What are the optimal conditions for reconstituting RnfE protein after purification to maintain functional activity?

Reconstitution of membrane proteins like RnfE requires careful consideration of buffer components and storage conditions. Based on protocols for similar electron transport proteins, researchers should:

  • Use deionized sterile water for initial reconstitution to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal around 50%) for long-term storage

  • Aliquot and store at -20°C/-80°C to prevent freeze-thaw cycles

  • For working solutions, maintain at 4°C for no more than one week

For functional studies, consider reconstitution into artificial membrane systems (liposomes or nanodiscs) using purified phospholipids at physiologically relevant ratios. This approach allows assessment of electron transport activity in a near-native environment. Critically, researchers should verify activity immediately after reconstitution using appropriate electron donor/acceptor pairs and spectrophotometric assays.

How can researchers effectively study protein-protein interactions between RnfE and other components of the electron transport complex?

Studying protein-protein interactions within the electron transport complex requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against RnfE or epitope tags to pull down interaction partners from Salmonella lysates

  • Bacterial Two-Hybrid (B2H) System: Construct fusion proteins with DNA-binding and activation domains to detect interactions through reporter gene activation

  • Surface Plasmon Resonance (SPR): Measure real-time binding kinetics between purified RnfE and potential partners

  • Crosslinking Mass Spectrometry: Use chemical crosslinkers followed by mass spectrometry to identify interaction interfaces

For the electron transport complex specifically, researchers should consider native gel electrophoresis (Blue Native-PAGE) to isolate intact complexes, followed by second-dimension SDS-PAGE to identify individual components. This approach can preserve physiologically relevant interactions that might be disrupted in other techniques .

What approaches can be used to study the role of iron-sulfur clusters in RnfE function?

Iron-sulfur clusters are critical components of electron transport proteins. To study their role in RnfE:

  • Site-directed mutagenesis: Modify predicted iron-sulfur cluster binding residues (typically cysteine residues arranged in CXnCXnC motifs) and assess effects on protein function

  • EPR Spectroscopy: Characterize the redox properties and electronic structure of iron-sulfur clusters in purified RnfE

  • Iron and sulfur quantification: Use colorimetric assays to determine stoichiometry of iron and sulfur in purified RnfE

  • Reconstitution experiments: Remove iron-sulfur clusters using chelating agents and assess activity before and after reconstitution with iron and sulfide under anaerobic conditions

Researchers should note that iron-sulfur proteins are oxygen-sensitive, so purification and analysis should ideally be performed under anaerobic conditions using specialized equipment such as glove boxes .

What structural features distinguish RnfE from other components of the electron transport complex, and how do these relate to function?

While specific structural information about RnfE is limited in the search results, comparisons can be made to related proteins like RnfB . Based on sequence analysis and functional studies of electron transport complex proteins:

  • Transmembrane domains: Analyze the sequence for hydrophobic regions that may anchor the protein in the membrane using prediction algorithms (TMHMM, HMMTOP)

  • Conserved motifs: Identify sequence motifs involved in cofactor binding (particularly for iron-sulfur clusters) through multiple sequence alignments with other Rnf proteins

  • Functional domains: Use tools like InterPro and Pfam to predict domains with known functions

For experimental structure determination, researchers should consider X-ray crystallography (if the protein can be crystallized) or cryo-electron microscopy for the entire complex. For membrane proteins, detergent selection is critical for maintaining native structure during purification and analysis .

How can researchers assess the contribution of RnfE to electron transport and energy conservation in Salmonella enteritidis?

To assess RnfE's contribution to electron transport and energy conservation:

  • Growth phenotype analysis: Compare growth of wild-type and rnfE deletion mutants under different respiratory conditions (aerobic, anaerobic with various electron acceptors)

  • Membrane potential measurements: Use voltage-sensitive fluorescent dyes to measure membrane potential in wild-type versus mutant strains

  • Respiration rate measurements: Measure oxygen consumption or alternative electron acceptor reduction rates in membrane vesicles from wild-type and mutant strains

  • Reconstituted systems: Incorporate purified recombinant RnfE into liposomes and measure ion pumping activity using pH-sensitive or ion-selective probes

Additionally, researchers can employ isotope labeling techniques to track electron flow through metabolic pathways in the presence and absence of functional RnfE .

What is the relationship between RnfE and bacterial pathogenesis in Salmonella enteritidis infections?

The relationship between electron transport proteins and bacterial pathogenesis represents an important research direction. To investigate RnfE's role in Salmonella virulence:

  • Infection models: Compare virulence of wild-type and rnfE mutant strains in appropriate cell culture and animal models

  • Gene expression analysis: Examine expression patterns of rnfE during different stages of infection using qRT-PCR or RNA-seq

  • Metabolic profiling: Compare metabolite profiles of wild-type and mutant strains under infection-relevant conditions

  • Host response assessment: Measure host immune responses to wild-type versus mutant strains

Since Salmonella must adapt to different environments during infection (including low oxygen, nutrient limitation, and host defense mechanisms), electron transport proteins like RnfE may play critical roles in maintaining metabolic flexibility during pathogenesis .

How can recombinant RnfE protein be used as a tool for studying bacterial metabolism and bioenergetics?

Recombinant RnfE can serve as a valuable research tool:

  • In vitro reconstitution: Incorporate purified RnfE into artificial membrane systems to study electron transport mechanisms

  • Inhibitor screening: Use activity assays with recombinant RnfE to identify specific inhibitors that could serve as antimicrobial leads

  • Interaction studies: Employ labeled recombinant RnfE to identify interaction partners in complex biological samples

  • Structural biology: Use purified protein for structural studies via X-ray crystallography, NMR, or cryo-EM

The methodological approach should include expression optimization to obtain high yields of functional protein, rigorous quality control to ensure consistent activity, and development of robust activity assays that can be performed reproducibly across different laboratories .

What insights can comparative studies of RnfE across different Salmonella strains provide?

Comparative studies of RnfE across different Salmonella strains can yield valuable insights:

Research ApproachPotential InsightsMethodological Considerations
Sequence analysisEvolutionary conservation and selection pressureRequires curated databases and appropriate phylogenetic tools
Expression profilingStrain-specific regulation patternsShould control for growth conditions and environmental factors
Functional comparisonDifferential activity or substrate specificityRequires standardized activity assays across strains
Structural variationAdaptive changes related to niche specializationMay require structural prediction algorithms and validation

Researchers should employ both bioinformatic approaches to analyze sequences and experimental methods to confirm functional differences. This comparative approach can reveal how electron transport adaptations contribute to strain-specific metabolic capabilities and potentially virulence differences .

How can research on RnfE contribute to the development of new antimicrobial strategies?

Research on bacterial electron transport proteins like RnfE has potential applications in antimicrobial development:

  • Target validation: Determine if RnfE is essential for Salmonella survival or virulence through gene deletion and complementation studies

  • High-throughput screening: Develop assays using recombinant RnfE to screen compound libraries for specific inhibitors

  • Structure-based drug design: Use structural information to design inhibitors targeting critical functional regions of RnfE

  • Combination therapy approaches: Investigate synergy between RnfE inhibitors and existing antibiotics

The methodological approach should include validation of hits from screening in whole-cell assays, assessment of specificity against mammalian homologs (if any), and evaluation of resistance development potential .

What are common challenges in expressing and purifying RnfE, and how can researchers overcome them?

Based on experience with similar electron transport proteins:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Consider specialized expression strains designed for membrane proteins

  • Protein insolubility:

    • Use fusion tags that enhance solubility (MBP, SUMO, etc.)

    • Express at lower temperatures (16-20°C) to slow folding

    • Screen different detergents for membrane protein solubilization

  • Loss of cofactors:

    • Supplement growth media with iron sources for iron-sulfur proteins

    • Include stabilizing agents in purification buffers

    • Consider anaerobic purification for oxygen-sensitive cofactors

  • Aggregation during storage:

    • Add glycerol (5-50%) to storage buffers

    • Store as small aliquots to prevent freeze-thaw cycles

    • Consider lyophilization for long-term storage

How can researchers optimize activity assays for RnfE to ensure reliable and reproducible results?

Activity assay optimization is critical for reliable research outcomes:

  • Buffer optimization:

    • Test different pH values within physiological range

    • Assess ionic strength effects on activity

    • Evaluate the impact of different stabilizing agents

  • Substrate selection:

    • Identify physiologically relevant electron donors/acceptors

    • Determine optimal substrate concentrations through kinetic analysis

    • Consider artificial substrates with improved detection properties

  • Detection method selection:

    • For redox reactions, use spectrophotometric methods with appropriate wavelengths

    • Consider coupled enzyme assays for amplifying signals

    • Evaluate electrochemical methods for direct electron transfer measurement

  • Quality control:

    • Include positive and negative controls in each assay

    • Establish acceptance criteria for assay performance

    • Implement statistical methods to assess reproducibility

What strategies can researchers employ when studying protein-protein interactions involving RnfE in the context of the full electron transport complex?

Studying protein-protein interactions within membrane-bound complexes presents unique challenges:

  • Membrane mimetic selection:

    • Test different detergents for complex stability

    • Consider nanodiscs or liposomes for more native-like environments

    • Evaluate styrene-maleic acid copolymer (SMA) extraction for native lipid co-purification

  • Crosslinking optimization:

    • Test different crosslinker chemistries and spacer lengths

    • Optimize crosslinking conditions (time, temperature, concentration)

    • Use MS-compatible crosslinkers for downstream analysis

  • Co-expression strategies:

    • Design multi-cistronic constructs to express multiple complex components

    • Balance expression levels to promote proper complex assembly

    • Consider sequential induction strategies for different components

  • Complex isolation:

    • Develop gentle purification protocols to maintain intact complexes

    • Use affinity tags on different components for verification of complex integrity

    • Consider native gel electrophoresis for complex visualization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.