Recombinant Salmonella enteritidis PT4 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; SEN4111; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALFW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (anaerobic growth) and succinate dehydrogenase (aerobic growth). FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links

KEGG: set:SEN4111

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does frdC function in the context of Salmonella metabolism and pathogenesis?

The frdC protein serves as an essential component of the fumarate reductase complex, which plays a critical role in anaerobic respiration in Salmonella. This complex enables the bacterium to use fumarate as a terminal electron acceptor when oxygen is limited or absent, particularly during gut colonization .

Research indicates that fumarate respiration can function independently of external fumarate by utilizing monosaccharides or L-aspartate, making it a crucial metabolic pathway for initial bacterial growth in anaerobic environments where inorganic electron acceptors are scarce . Experimental evidence from various mouse infection models demonstrates that mutants deficient in fumarate respiration (Δfrd) show 10 to 100-fold attenuation in colonization capability compared to wild-type strains, highlighting its significance in pathogenesis .

The importance of this metabolic pathway is context-independent, meaning fumarate respiration remains essential for Salmonella colonization across different host environments, unlike other metabolic pathways (such as hydrogen utilization) that show context-dependent importance .

What are the optimal storage and handling conditions for recombinant frdC to maintain stability?

For optimal stability of recombinant Salmonella enteritidis PT4 frdC protein, researchers should implement the following evidence-based storage and handling protocols:

  • Standard storage: Store the protein at -20°C for routine use .

  • Long-term storage: For extended preservation, maintain at either -20°C or preferably -80°C to minimize degradation .

  • Buffer composition: The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for this specific protein's stability .

  • Working aliquots: Store working aliquots at 4°C for up to one week to avoid repeated freeze-thaw cycles .

  • Avoid repeated freeze-thaw cycles: This is explicitly not recommended as it can lead to protein denaturation and loss of activity .

If the protein is supplied in lyophilized form, reconstitute it in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding glycerol to a final concentration of 5-50% before aliquoting for long-term storage .

How can recombinant frdC be used in Salmonella pathogenesis studies?

Recombinant frdC protein can be utilized in multiple experimental approaches to investigate Salmonella pathogenesis:

  • Immunological studies: The purified protein can be used to generate antibodies for tracking frdC expression during infection or for immunoprecipitation studies to identify interaction partners.

  • Functional complementation: In studies using frdC knockout strains (ΔfrdC), the recombinant protein can be used for complementation assays to confirm that observed phenotypes are specifically due to the absence of frdC rather than polar effects or secondary mutations.

  • Competition assays: As demonstrated in research, fumarate respiration is critical for Salmonella colonization. Recombinant frdC can be employed in in vitro competition experiments comparing wild-type and modified proteins to assess the importance of specific residues or domains .

  • Metabolic pathway analysis: The protein can be used in enzymatic assays to study the kinetics of fumarate reduction and to understand how this process contributes to Salmonella's metabolic adaptability during infection.

  • Structural studies: Purified recombinant frdC can be utilized for structural analyses using techniques such as X-ray crystallography or cryo-electron microscopy to understand the molecular basis of its function within the fumarate reductase complex.

Research has confirmed that fumarate respiration is critical for Salmonella colonization across various mouse models, with frd-deficient strains showing 10-100 fold attenuation in colonization capability .

What methodologies can be used to generate frdC knockouts in Salmonella for functional studies?

Based on established research protocols, the Lambda Red recombination system has proven highly effective for generating frdC knockouts in Salmonella:

  • Primer design: Design primers with approximately 40 bp overhanging regions homologous to the genomic regions flanking the frdC gene and a 20 bp binding region corresponding to an antibiotic resistance cassette .

  • PCR amplification: Amplify the antibiotic resistance cassette using plasmids such as pKD4 (for kanamycin resistance) or pTWIST (for ampicillin resistance). Use DreamTaq Master Mix for PCR amplification .

  • Template DNA digestion: Digest the template DNA using FastDigest DpnI enzyme, followed by purification of the PCR product using a DNA purification kit .

  • Host strain preparation: Culture Salmonella strain (e.g., SB300) carrying either pKD46 or pSIM5 plasmid at 30°C until early exponential phase. Induce with L-arabinose (10 mM) or heat (42°C for 20 min), respectively .

  • Transformation: Wash cells in ice-cold glycerol (10% v/v) solution, concentrate 100-fold, and transform the PCR product by electroshock (1.8 V at 5 ms) .

  • Regeneration and selection: Regenerate cells in SOC medium for 2 hours at 37°C, and plate on selective LB-agar plates .

  • Verification: Confirm successful gene knockout by gel electrophoresis and Sanger sequencing .

  • Resistance cassette removal: If needed, eliminate antibiotic resistance cassettes via flippase (FLP) recombination for marker-free mutants .

This methodology has been successfully employed in studies investigating the role of fumarate respiration in Salmonella colonization, providing a reliable approach for generating precise gene knockouts .

How can researchers effectively study frdC protein interactions with other components of the fumarate reductase complex?

To effectively study interactions between frdC and other components of the fumarate reductase complex, researchers can employ multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using anti-His tag antibodies (for His-tagged recombinant frdC) or specific anti-frdC antibodies to pull down the protein complex from Salmonella lysates, followed by mass spectrometry to identify interacting partners.

  • Bacterial two-hybrid systems: These can be used to screen for direct protein-protein interactions between frdC and other subunits of the fumarate reductase complex (frdA, frdB, frdD) or potential regulatory proteins.

  • Microscale thermophoresis (MST): This technique can quantitatively measure binding affinities between purified recombinant frdC and other proteins or small molecules in solution.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking can capture transient interactions, and subsequent mass spectrometry analysis can identify interaction sites at amino acid resolution.

  • Structural biology approaches: Techniques such as X-ray crystallography or cryo-electron microscopy of the reconstituted complex can provide detailed insights into the spatial arrangement and interaction interfaces between frdC and other subunits.

  • Molecular dynamics simulations: Computational approaches can predict interaction dynamics and conformational changes that occur during complex assembly or function.

Research has established that fumarate respiration functions independently of external fumarate by utilizing monosaccharides or L-aspartate , suggesting that the frdC subunit may have specific interactions with metabolic enzymes beyond the core fumarate reductase complex.

How does frdC function differ between Salmonella enteritidis PT4 and related pathogens such as Salmonella Paratyphi A?

A comparative analysis of frdC proteins from Salmonella enteritidis PT4 and Salmonella Paratyphi A reveals both conservation and distinctions that may contribute to pathogen-specific virulence mechanisms:

Sequence comparison:

FeatureS. enteritidis PT4 frdCS. Paratyphi A frdCNotes
Length131 amino acids131 amino acidsIdentical length
UniProt IDB5R016Q5PL70Different accession numbers
Locus nameSEN4111SPA4158Different genomic organization
Amino acid sequenceMTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGFVGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVVTVVILYVALFWMTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGFVGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVVTVVILYVALFW100% sequence identity

Despite belonging to different Salmonella serovars with distinct host preferences and pathogenicity profiles, the frdC proteins from S. enteritidis PT4 and S. Paratyphi A exhibit 100% sequence identity at the amino acid level . This perfect conservation suggests that:

  • The frdC protein has an essential, highly conserved function in the fumarate respiration pathway that cannot tolerate sequence variations.

  • Despite differences in other virulence factors between these serovars, the core metabolic machinery for anaerobic respiration remains unchanged.

  • The functional importance of fumarate respiration for colonization, as demonstrated in multiple mouse models , likely extends across Salmonella serovars.

This high conservation makes recombinant frdC proteins from either serovar potentially interchangeable in functional studies, though the specific metabolic context and regulation may differ between serovars based on their adaptation to different host environments.

What is the significance of fumarate respiration in Salmonella gut colonization across different host microbiome contexts?

Fumarate respiration plays a critical and context-independent role in Salmonella gut colonization across varied host microbiome environments, as evidenced by comprehensive research using multiple mouse models:

  • Universal importance across microbiome contexts: Studies utilizing various mouse models—including germ-free, streptomycin-pretreated (microbiota-depleted), and defined microbiome models (LCM with 8 bacterial strains and OligoMM 12 with 12 strains)—consistently demonstrate that fumarate respiration mutants (Δfrd) show 10-100 fold attenuation in colonization compared to wild-type strains .

  • Independence from external electron acceptors: Unlike other anaerobic respiration pathways that require specific external electron acceptors, fumarate respiration can function independently of external fumarate by utilizing monosaccharides or L-aspartate as internal sources . This metabolic flexibility enables Salmonella to establish initial colonization regardless of the specific microbiome composition.

  • Contrast with context-dependent pathways: The consistent importance of fumarate respiration stands in contrast to other metabolic pathways, such as hydrogen utilization (Hyb), which shows context-dependent importance. Hyb-deficient strains exhibit no attenuation in germ-free and streptomycin-pretreated models but show 5-100 fold attenuation in LCM and OligoMM 12 models .

  • Temporal dynamics: In streptomycin-pretreated models, fumarate respiration becomes especially critical by day 2 post-infection, when competition with regrowing commensals intensifies .

This research demonstrates that fumarate respiration represents a core metabolic requirement for Salmonella gut colonization that transcends microbiome variability, making it a potential target for broad-spectrum intervention strategies against Salmonella infections regardless of the host's microbiome status.

How do monosaccharide utilization pathways interact with fumarate respiration during Salmonella colonization?

Research has revealed sophisticated interactions between monosaccharide utilization pathways and fumarate respiration during Salmonella colonization, with important implications for understanding pathogen metabolism:

  • Metabolic integration: Fumarate respiration can function independently of external fumarate by utilizing monosaccharides as internal sources, creating a direct metabolic link between carbohydrate utilization and anaerobic respiration . This integration allows Salmonella to maintain respiratory metabolism even in environments lacking external electron acceptors.

  • Monosaccharide-specific contributions: Multiple monosaccharide utilization pathways contribute to Salmonella colonization with varying importance:

    • D-fructose pathway: The fruK-deficient mutant shows consistent attenuation across all mouse models (10-1000 fold reduction), indicating context-independent importance similar to fumarate respiration .

    • D-mannose pathway: manA mutants are also attenuated across all models, with particularly severe attenuation in streptomycin-pretreated models .

    • D-galactose pathway: galK mutants show context-dependent attenuation only in germ-free and streptomycin-pretreated models .

  • Cumulative importance: Experimental data from colonization studies with multi-mutant strains reveal increasing colonization defects with each additional monosaccharide utilization pathway disruption:

    • Single manA mutant: ~100-fold reduction

    • Double (ΔmanA ΔfruK) and triple (ΔmanA ΔfruK ΔgalK) mutants: stable but reduced colonization

    • Quadruple mutant (ΔmanA ΔfruK ΔgalK ΔptsG): colony collapse by days 3-4

  • Temporal dynamics: The colonization kinetics of the quadruple monosaccharide utilization mutant resembles that of an avirulent Salmonella strain with disrupted type III secretion systems , suggesting that monosaccharide utilization is not only linked to fumarate respiration but also to virulence mechanism activation.

These findings demonstrate that monosaccharide utilization pathways provide essential metabolic inputs for fumarate respiration during gut colonization, with D-fructose and D-mannose pathways being particularly crucial across different host environments .

What are common challenges in working with recombinant frdC protein and how can they be addressed?

Researchers working with recombinant Salmonella enteritidis PT4 frdC protein may encounter several technical challenges due to its biochemical properties and functional characteristics. Here are evidence-based approaches to address these issues:

  • Protein solubility limitations:

    • Challenge: As a hydrophobic membrane protein (15 kDa hydrophobic protein) , frdC tends to aggregate when expressed recombinantly.

    • Solution: Optimize solubilization using detergents such as n-dodecyl β-D-maltoside (DDM) or Triton X-100. Alternative approaches include expressing fusion constructs with solubility-enhancing tags such as SUMO or MBP.

  • Maintaining native conformation:

    • Challenge: Ensuring the recombinant protein maintains its native structure outside of the membrane environment.

    • Solution: Consider using membrane-mimetic systems such as nanodiscs, liposomes, or amphipols to provide a lipid environment that supports native protein folding.

  • Functional assay development:

    • Challenge: As part of a multi-subunit complex, isolated frdC may not exhibit measurable activity independently.

    • Solution: Develop co-expression systems with other fumarate reductase subunits (frdA, frdB, frdD) to reconstitute the functional complex in vitro. Activity can then be measured using standard fumarate reduction assays.

  • Storage stability issues:

    • Challenge: Maintaining protein stability during storage.

    • Solution: Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Avoid repeated freeze-thaw cycles and keep working aliquots at 4°C for up to one week .

  • Protein quantification accuracy:

    • Challenge: Hydrophobic membrane proteins can interfere with standard protein quantification methods.

    • Solution: Compare multiple quantification methods (Bradford, BCA, and UV absorbance) and consider using amino acid analysis for absolute quantification when precise measurements are required.

These approaches are based on established protocols for membrane protein handling and the specific storage recommendations for recombinant frdC protein .

How can researchers reconcile contradictory data when studying frdC function in different experimental models?

When confronted with contradictory data regarding frdC function across different experimental models, researchers should implement a systematic approach to reconcile these discrepancies:

  • Context-dependent vs. context-independent effects:

    • Unlike some metabolic pathways that show variable importance depending on the microbiome context (e.g., hydrogen utilization), fumarate respiration consistently demonstrates importance across different mouse models .

    • When contradictory results emerge, analyze whether they represent true biological variability or technical artifacts by examining:

      • Genetic background differences in Salmonella strains

      • Variations in host models (e.g., different mouse strains or microbiome compositions)

      • Temporal factors in colonization experiments

  • Standardized data normalization:

    • Implement competitive index (CI) calculations to normalize data across experiments .

    • When pooled mutant libraries are used, ensure proper normalization for input inoculum composition and potential population bottlenecks.

  • Integrated data analysis framework:

    Data integration levelAnalysis approachApplication to frdC research
    Within-model validationCompare technical and biological replicatesVerify consistent attenuation of frdC mutants in the same model
    Cross-model comparisonExamine fold-change consistency rather than absolute valuesCompare attenuation ratios of frdC mutants across different mouse models
    Temporal analysisTrack changes over infection time courseEvaluate whether frdC importance changes during colonization progression
    Genetic interaction mappingTest epistatic relationships with other mutationsDetermine interaction between frdC and monosaccharide utilization pathways
  • Mechanistic validation:

    • When contradictory results persist, design experiments to test underlying mechanisms, such as:

      • Complementation studies with wild-type frdC to confirm phenotype rescue

      • Site-directed mutagenesis to identify critical residues

      • Metabolomic profiling to track metabolic pathway utilization in different models

  • Mathematical modeling:

    • Develop quantitative models incorporating parameters from different experimental conditions to reconcile seemingly contradictory observations.

    • Use these models to generate predictions that can be experimentally tested.

This systematic approach accounts for the observation that while fumarate respiration shows context-independent importance, its relative contribution compared to other pathways may vary across models and conditions .

What are promising research avenues for developing targeted interventions based on frdC function?

Based on current understanding of frdC function in Salmonella colonization, several promising research avenues exist for developing targeted interventions:

  • Small molecule inhibitors of fumarate reductase:

    • The consistent importance of fumarate respiration across different host microbiome contexts suggests that specific inhibitors of the fumarate reductase complex could be broadly effective anti-Salmonella agents.

    • Research should focus on:

      • Structure-based design of inhibitors targeting the interaction between frdC and other subunits

      • Screening for compounds that destabilize the membrane association of the complex

      • Development of prodrugs that are activated in the anaerobic gut environment

  • Metabolic pathway competition strategies:

    • Since fumarate respiration functions by utilizing monosaccharides or L-aspartate , research into prebiotics or small molecules that compete for these substrates could potentially reduce Salmonella colonization capacity.

    • This approach could involve:

      • Identifying probiotic strains that efficiently compete for the same metabolic resources

      • Developing non-metabolizable substrate analogs that competitively inhibit key enzymes

  • Vaccine development targeting conserved epitopes:

    • The 100% sequence identity observed between frdC proteins from different Salmonella serovars suggests that conserved epitopes could serve as vaccine targets with broad coverage.

    • Research directions include:

      • Identification of immunogenic epitopes within frdC that are accessible to the immune system

      • Development of subunit vaccines incorporating these epitopes

      • Evaluation of cross-protection against multiple Salmonella serovars

  • Combination therapies targeting metabolic vulnerabilities:

    • Research into the synergistic effects of simultaneously targeting fumarate respiration and specific monosaccharide utilization pathways could lead to more effective interventions.

    • This could involve:

      • Testing combinations of inhibitors targeting both frdC and key enzymes in monosaccharide metabolism (e.g., fruK, manA)

      • Evaluating temporal administration strategies that target different metabolic pathways at specific stages of infection

  • Microbiome modulation strategies:

    • While fumarate respiration is important across microbiome contexts , research into microbiome compositions that specifically increase competition for resources needed for this pathway could yield novel preventative approaches.

These research directions leverage the context-independent importance of fumarate respiration while acknowledging its interconnections with other metabolic pathways that contribute to Salmonella pathogenesis.

How might advanced structural biology techniques advance our understanding of frdC function in the fumarate reductase complex?

Advanced structural biology techniques offer significant potential to deepen our understanding of frdC function within the fumarate reductase complex:

  • Cryo-electron microscopy (Cryo-EM):

    • Can provide high-resolution structures of the entire membrane-embedded fumarate reductase complex, including frdC in its native lipid environment

    • Potential insights include:

      • Visualization of conformational changes during the catalytic cycle

      • Identification of critical interaction interfaces between frdC and other subunits

      • Understanding of how the complex associates with the membrane

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Enables mapping of protein dynamics and solvent accessibility

    • Applications for frdC research:

      • Identification of regions that undergo conformational changes during complex assembly

      • Mapping of potential allosteric sites that influence complex activity

      • Detection of interaction surfaces with metabolic enzymes or regulatory proteins

  • Integrative structural biology approaches:

    • Combination of multiple techniques (X-ray crystallography, NMR, SAXS, crosslinking-MS)

    • Benefits for frdC studies:

      • Overcoming limitations of individual methods for membrane protein analysis

      • Building comprehensive models of the dynamic functional complex

      • Correlating structural features with biochemical and genetic data

  • In situ structural techniques:

    • Methods such as cellular cryo-electron tomography and correlative light and electron microscopy

    • Potential applications:

      • Visualizing the native organization of fumarate reductase complexes in bacterial membranes

      • Understanding spatial distribution and clustering during different metabolic states

      • Correlating structural features with colonial growth and biofilm formation

  • Computational structural biology:

    • Molecular dynamics simulations and AI-based structure prediction (e.g., AlphaFold)

    • Research opportunities:

      • Predicting conformational dynamics of frdC within the membrane environment

      • Virtual screening for potential inhibitors targeting specific structural features

      • Modeling the impact of mutations on complex stability and function

How should researchers integrate knowledge about frdC into broader studies of bacterial metabolism and pathogenesis?

Researchers should adopt a systems biology perspective when integrating knowledge about frdC into broader studies of bacterial metabolism and pathogenesis:

  • Metabolic network integration: Recognize that fumarate respiration exists within a complex metabolic network, with demonstrated connections to monosaccharide utilization pathways . Studies should map these interconnections quantitatively to understand how perturbations in one pathway affect others.

  • Host-pathogen-microbiome interactions: While frdC function shows context-independent importance across different microbiome states , its relative contribution to pathogenesis may vary. Researchers should design experiments that explicitly test frdC function across defined microbiome compositions.

  • Temporal dynamics consideration: Evidence shows that the importance of metabolic pathways changes during the course of infection . Experimental designs should incorporate time-course analyses rather than single endpoints to capture these dynamics.

  • Comparative genomics approach: The high conservation of frdC across Salmonella serovars suggests evolutionary pressure to maintain this function. Comparative studies across diverse enteric pathogens may reveal common principles of metabolic adaptation during gut colonization.

  • Translational pathway development: Knowledge of frdC function should inform rational design of intervention strategies, potentially targeting conserved features of anaerobic respiration shared across pathogens rather than Salmonella-specific virulence factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.