Recombinant Salmonella enteritidis PT4 Fumarate reductase subunit D (frdD)

What is Fumarate reductase subunit D (frdD) and what role does it play in Salmonella enteritidis PT4?

Fumarate reductase subunit D (frdD) is a membrane-anchoring protein that appears to be involved in attaching the catalytic components of the fumarate reductase complex to the cytoplasmic membrane of Salmonella enteritidis PT4. The protein belongs to the FrdD family, has a length of 119 amino acids, and a molecular mass of approximately 13 kDa .

In Salmonella, the fumarate reductase complex is critical for anaerobic respiration, where fumarate serves as the terminal electron acceptor instead of oxygen. This respiratory pathway is particularly important during intestinal colonization, where oxygen is limited. Research has demonstrated that fumarate respiratory genes, including frdD, are significantly up-regulated during the colonization of chicken caeca, suggesting their importance in the adaptation to the intestinal environment .

The functional significance of frdD lies in its contribution to establishing a successful colonization in the host, which is a prerequisite for Salmonella pathogenesis. By anchoring the catalytic components to the membrane, frdD ensures the proper localization and functioning of the fumarate reductase complex, enabling the bacterium to generate energy under the anaerobic conditions of the intestine.

What methodologies are recommended for creating recombinant Salmonella enteritidis PT4 frdD mutants?

Creating recombinant Salmonella enteritidis PT4 frdD mutants typically involves homologous recombination techniques. The following methodological approach is recommended:

PCR-Based Homologous Recombination (Recombineering)

• Design PCR primers (~70 nucleotides) with:

  • 50 bp homology to the regions flanking the frdD gene

  • 20 bp homology to the selectable marker (e.g., antibiotic resistance gene)

• Create the recombination substrate by amplifying a selectable marker using the designed primers, resulting in a PCR product with homologous ends to the target site .

• Transform the linear DNA substrate into electrocompetent Salmonella cells expressing phage-based recombination systems (λ Red or RecET) .

• Allow recovery after electroporation and select for recombinants using appropriate antibiotics.

• Confirm successful recombination by PCR, sequencing, and/or restriction analysis .

Two-Step Deletion Strategy for Marker-Free Mutants

• First step: Replace the frdD gene with a cassette containing both a selectable marker (e.g., kanamycin resistance) and a counter-selectable marker.

• Second step: Replace the cassette with a synthetic oligonucleotide containing the desired mutation or deletion .

The choice between λ Red and RecET recombination systems should be based on the specific experimental goals. The λ Red system is generally superior for targeting the bacterial chromosome, while the RecET system works better for recombining two linear DNA molecules .

How does frdD expression change during intestinal colonization by Salmonella enteritidis PT4?

Transcriptional analysis of Salmonella enteritidis PT4 during intestinal colonization of chickens has revealed significant changes in gene expression patterns compared to in vitro growth conditions. Microarray analysis of Salmonella during cecal colonization demonstrates that fumarate respiratory genes, including frdD, are significantly up-regulated in vivo .

This up-regulation reflects the adaptation of Salmonella to the anaerobic environment of the chicken intestine, where fumarate respiration becomes essential for energy generation. The table below summarizes key findings regarding frdD expression during intestinal colonization:

The up-regulation of frdD during colonization underscores its importance in the establishment of Salmonella in the intestinal niche. This expression pattern is part of a broader metabolic shift toward energy generation pathways optimized for the caecal environment, with approximately 34% of Salmonella genes showing significant changes in expression levels during colonization .

What protein-protein interactions does frdD participate in within the fumarate reductase complex?

The fumarate reductase complex in Salmonella enteritidis PT4 consists of four subunits (FrdA, FrdB, FrdC, and FrdD), with FrdD serving as one of the membrane-anchoring components. Research indicates that FrdD participates in several critical protein-protein interactions that are essential for the assembly and function of the complex:

Key Protein-Protein Interactions:

• FrdD-FrdC Interaction: FrdD works in concert with FrdC (the other membrane anchor protein) to form a stable membrane anchor complex. Both proteins contain transmembrane domains that integrate into the cytoplasmic membrane .

• FrdD/FrdC-FrdAB Interaction: The membrane anchor subunits (FrdD/FrdC) interact with the catalytic dimer composed of FrdA and FrdB, effectively anchoring the catalytic components to the membrane where they can access both the quinone pool and the fumarate substrate.

The interaction between these subunits is facilitated by specific structural features of FrdD:

• Hydrophobic transmembrane domains enable integration into the lipid bilayer

• Specific amino acid sequences (MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL) contain recognition motifs for subunit assembly

Investigating these protein-protein interactions typically requires specialized techniques such as:

• Cross-linking studies followed by mass spectrometry

• Co-immunoprecipitation assays

• Bacterial two-hybrid systems

• Modified methods for investigating protein-protein interactions in pathogenic bacteria

Understanding these interactions is crucial for comprehending the assembly and function of the fumarate reductase complex and may provide insights for developing targeted inhibitors that disrupt these interactions.

What expression systems are most efficient for producing recombinant frdD protein for structural studies?

Producing functional recombinant frdD for structural studies presents specific challenges due to its hydrophobic nature and membrane association. Several expression systems have been evaluated, with varying degrees of success:

coli-Based Expression Systems:

• BL21(DE3) with pET Vector System:

  • Advantages: High expression levels, tight regulation via T7 promoter

  • Limitations: Membrane proteins often form inclusion bodies

  • Modifications: Fusion tags (MBP, SUMO) can improve solubility

  • Expression conditions: Induction at lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) improve proper folding

• C41(DE3) and C43(DE3) Strains:

  • Specifically designed for membrane protein expression

  • Contain mutations that prevent toxic effects of membrane protein overexpression

  • Show higher success rates for integral membrane proteins like frdD

Detergent Selection for Purification:

The choice of detergent is critical for successful purification of functional frdD:

Co-Expression Strategies:

Co-expressing frdD with its partner proteins (frdA, frdB, and frdC) has shown improved results for obtaining properly folded and functional protein. This approach mimics the natural assembly of the complex and can improve the stability and solubility of individual subunits.

How can single-gene and multi-gene deletion mutant collections be utilized to study frdD function?

Comprehensive deletion mutant collections offer powerful tools for studying the function of genes like frdD in Salmonella enteritidis PT4. Two main approaches can be employed:

Single-Gene Deletion (SGD) Approach:

Single-gene deletion mutants allow for the precise study of frdD function in isolation. Collections such as those developed for Salmonella enterica sv Typhimurium provide valuable resources :

• Specific frdD knockout strategies:

  • Replacement with kanamycin resistance gene (Kan^R) in the sense direction

  • Replacement with chloramphenicol resistance gene (Cam^R) in the antisense direction

• Phenotypic analysis of frdD mutants:

  • Growth characteristics under anaerobic conditions

  • Colonization ability in animal models

  • Metabolic profiling to assess changes in fumarate metabolism

  • Virulence assessment in appropriate models

• Complementation studies:

  • Re-introduction of wild-type frdD on expression vectors

  • Site-directed mutagenesis to identify critical residues

Multi-Gene Deletion (MGD) Approach:

Multi-gene deletion collections can reveal functional relationships between frdD and other genes:

• Deletion of entire frd operon (frdABCD):

  • Allows assessment of the complete fumarate reductase system

  • Eliminates compensatory effects from other subunits

• Hierarchical screening strategy :

  • Initial screening using MGDs containing frdD region

  • Follow-up analysis with specific SGDs within identified regions

  • This approach efficiently identifies genetic interactions

• Combinatorial analysis:

  • Different antibiotic markers enable construction of multiple mutant combinations

  • Allows study of functional redundancy and compensatory pathways

The availability of both SGD and MGD collections with different antibiotic markers provides remarkable flexibility in experimental design. Researchers can construct all viable combinations of mutants in the same genetic background, enabling comprehensive analysis of genetic interactions involving frdD .

What are the technical challenges in measuring frdD expression levels during in vivo colonization experiments?

Measuring frdD expression levels during in vivo colonization presents several technical challenges that researchers must address to obtain reliable data:

Sampling and RNA Preservation Challenges:

• Tissue sampling limitations:

  • Small bacterial population size in host tissues

  • Need for rapid sample processing to prevent RNA degradation

  • Contamination with host tissue affecting RNA purity

• RNA quality and quantity issues:

  • Low bacterial RNA yield from in vivo samples

  • RNA degradation during extraction procedures

  • Host RNA contamination requiring bacterial RNA enrichment

Recommended Methodological Approaches:

• RNA stabilization protocols:

  • Immediate tissue immersion in RNAlater or flash freezing

  • Use of specialized bacterial RNA preservation solutions

  • Rapid processing times to minimize degradation

• Bacterial enrichment techniques:

  • Selective lysis of host cells

  • Immunomagnetic separation of bacterial cells

  • Differential centrifugation protocols

• Sensitive detection methods:

  • Quantitative RT-PCR with frdD-specific primers

  • RNA-seq with bacterial-specific rRNA depletion

  • Microarray analysis with appropriate controls

• Alternative expression monitoring approaches:

  • Reporter gene fusions (e.g., frdD-GFP)

  • Two-color flow cytometry for studying in vivo expression

  • Fluorescence microscopy for spatial distribution in tissues

The microarray approach has been successfully used to characterize the Salmonella enteritidis PT4 transcriptome during cecal colonization, revealing the up-regulation of fumarate respiratory genes including frdD. This method achieved 96% compatibility with real-time PCR validation, demonstrating its reliability for expression analysis .

How does frdD contribute to Salmonella survival under anaerobic and osmotic stress conditions?

The fumarate reductase subunit D (frdD) plays a crucial role in Salmonella survival under both anaerobic and osmotic stress conditions, which are common environmental challenges in the intestinal niche:

Anaerobic Adaptation Mechanisms:

• Energy generation under oxygen limitation:

  • As part of the fumarate reductase complex, frdD enables anaerobic respiration using fumarate as the terminal electron acceptor

  • This provides an alternative energy generation pathway when oxygen is unavailable

  • Experimental evidence shows growth inhibition of frdD mutants under anaerobic conditions

• Redox balance maintenance:

  • The fumarate reductase reaction regenerates oxidized cofactors (FAD, NAD+)

  • This enables continued operation of glycolysis and TCA cycle under anaerobic conditions

  • Prevents accumulation of reduced electron carriers that would halt metabolism

Osmotic Stress Response:

Interestingly, microarray analysis has revealed that frdD and other fumarate respiratory genes are also up-regulated during osmotic stress response in Salmonella . The relationship between anaerobic respiration and osmotic stress adaptation includes:

• Metabolic adaptations:

  • Osmotic stress alters membrane properties and cellular bioenergetics

  • Fumarate reductase activity helps maintain proton motive force under these conditions

  • Competitive growth experiments show variable responses of fumarate reductase mutants under osmotic environments

• Coordinated regulation:

  • Common regulatory pathways control both anaerobic and osmotic stress responses

  • This coordination ensures appropriate expression of frdD in intestinal environments where both stresses occur simultaneously

The experimental evidence for frdD's role in these stress responses comes from competitive growth assays under anaerobic and osmotic conditions, where frdD mutants show varying degrees of growth impairment compared to wild-type Salmonella . This underscores the importance of frdD in the adaptation of Salmonella to the challenging conditions encountered during intestinal colonization.

What recombinant strategies can be employed to modify frdD for improved biochemical studies?

Several recombinant strategies can be employed to modify frdD for enhanced biochemical characterization:

Fusion Tag Approaches:

• Affinity Tags for Purification:

  • N-terminal or C-terminal His6 tags for IMAC purification

  • Careful placement to avoid interference with membrane integration

  • TEV or other protease cleavage sites for tag removal

• Solubility-Enhancing Tags:

  • MBP (Maltose Binding Protein) fusions to increase solubility

  • SUMO fusion for improved folding and solubility

  • Truncated versions retaining key functional domains

• Fluorescent Protein Fusions:

  • GFP fusion constructs for monitoring expression and localization

  • GFP_OVA fusions for combined T-cell response and expression studies

Optimized Expression Constructs:

• Promoter selection:

  • Inducible promoters (pTac, pTet, pBAD) for controlled expression levels

  • IVI (In Vivo-Induced) promoters like pPagC for expression under relevant conditions

  • Native promoter constructs to maintain physiological expression levels

• Codon optimization:

  • Adjustment of codon usage for the expression host

  • Removal of rare codons that may cause translational pausing

  • Optimization of GC content and removal of secondary structures in mRNA

• Directed evolution approaches:

  • Random mutagenesis libraries to identify variants with improved properties

  • Selection or screening systems to identify functionally enhanced variants

Site-Directed Mutagenesis Strategies:

Targeted mutations can provide valuable insights into structure-function relationships:

These recombinant approaches can significantly enhance biochemical studies by improving protein yield, stability, and enabling various analytical techniques that would be difficult with the native protein.

How does the function of frdD in Salmonella enteritidis PT4 compare to homologous proteins in other pathogens?

The function of fumarate reductase subunit D (frdD) in Salmonella enteritidis PT4 can be compared with homologous proteins in other bacterial pathogens to understand both conserved and divergent aspects:

Evolutionary Conservation and Divergence:

The FrdD family of proteins is highly conserved across many bacterial species, particularly among facultative anaerobes. Comparative analysis reveals:

• Sequence conservation:

  • High sequence similarity in transmembrane domains across Enterobacteriaceae

  • Greater divergence in loop regions between membrane-spanning segments

  • Conservation of key residues involved in interaction with other subunits

• Structural homology:

  • Consistent predicted secondary structure (predominantly α-helical)

  • Similar membrane topology across species

  • Conserved protein-protein interaction interfaces

Functional Comparison Across Pathogens:

Pathogenesis and Host Adaptation:

While the biochemical function of fumarate reductase is conserved, its role in pathogenesis varies:

• Tissue tropism:

  • In Salmonella, frdD contributes to intestinal colonization

  • In H. pylori, the homologous protein supports survival in the acidic stomach environment

  • In M. tuberculosis, alternative systems function in granulomas

• Adaptation to host environments:

  • Salmonella frdD is up-regulated during colonization of chicken caeca

  • E. coli frdD shows similar expression patterns in mammalian intestines

  • Expression regulation differs based on host-specific environmental cues

Understanding these similarities and differences provides valuable context for interpreting research findings and potentially identifies unique aspects of frdD function that could be exploited for Salmonella-specific interventions.