Recombinant Salmonella enteritidis PT4 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Research Applications

  • Vaccine Development: Used as an antigen to generate immune responses against Salmonella infections .

  • Functional Studies: Investigates lipid metabolism pathways and membrane biogenesis in Salmonella enteritidis PT4 .

  • Comparative Genomics: Supports analyses of virulence gene conservation across Salmonella serotypes .

Functional Insights from Genomic Studies

Virulence Context

  • plsY is part of the core genome of Salmonella enteritidis PT4, a strain harboring 12 pathogenicity islands (SPIs) and type III secretion systems (T3SS) critical for host invasion .

  • While not directly a virulence factor, plsY’s role in membrane lipid synthesis indirectly supports bacterial survival in host environments .

Phenotypic Relevance

  • Strains with disrupted lipid biosynthesis (e.g., via plsY inhibition) show reduced membrane integrity and impaired colonization in murine models .

Comparative Analysis with Related Proteins

FeatureplsY (PT4)plsY (S. Typhimurium)
Amino Acid Length203 aa202 aa
Catalytic EfficiencyHigh (Km = 0.8 μM)Moderate (Km = 1.2 μM)
Host AdaptationOptimized for poultryBroad host range

Challenges and Future Directions

  • Expression Optimization: Heterologous production in E. coli occasionally results in insoluble aggregates, necessitating refolding protocols .

  • Therapeutic Potential: Engineered plsY variants could serve as targets for novel antimicrobials disrupting lipid biosynthesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
plsY; ygiH; SEN3049; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor but not acyl-PO(4).
Database Links

KEGG: set:SEN3049

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) in Salmonella enteritidis PT4 and what is its primary function?

Glycerol-3-phosphate acyltransferase (plsY) in Salmonella enteritidis PT4 is an essential enzyme involved in bacterial phospholipid biosynthesis. It catalyzes the transfer of an acyl group to glycerol-3-phosphate, forming lysophosphatidic acid, a critical intermediate in membrane phospholipid synthesis. The protein is also known as G3P acyltransferase or GPAT, and functions as a lysophosphatidic acid synthase (LPA synthase) with EC classification numbers 2.3.1.15 and 2.3.1.n5 . This enzyme is crucial for maintaining membrane integrity in Salmonella enteritidis PT4, as phospholipids constitute a significant portion of bacterial membranes. The gene encoding this protein (plsY, with synonyms ygiH) is located within the bacterial chromosome at locus SEN3049 in the Salmonella enteritidis PT4 strain P125109 .

How does plsY contribute to the virulence and pathogenicity of Salmonella enteritidis PT4?

While plsY is not directly classified as a virulence factor in the provided genomic analysis of Salmonella enteritidis PT4, it plays an indirect but critical role in pathogenicity through its function in bacterial membrane biosynthesis. Proper membrane structure is essential for bacterial survival, resistance to environmental stresses, and host-pathogen interactions. The genomic analysis of Salmonella enteritidis PT4 strain 578 revealed that 3.66% of its coding sequences are virulence factors associated with cell invasion, intestinal colonization, and intracellular survival . Although plsY was not specifically identified among these 165 virulence genes, its role in maintaining membrane integrity supports the function of membrane-embedded virulence factors, including those in the type III secretion systems (T3SS) encoded by Salmonella pathogenicity islands SPI-1 and SPI-2 .

The connection between membrane phospholipid composition and bacterial virulence has been established in various pathogens, where alterations in membrane structure can affect the function of virulence-associated proteins, bacterial adhesion to host cells, and resistance to host defense mechanisms. In the context of Salmonella enteritidis PT4 infections, which are frequently associated with consumption of contaminated poultry products and eggs , proper membrane function supported by plsY activity would be essential for survival in various environments, including the acidic conditions of the stomach and the intracellular environment during infection.

What expression systems are most effective for producing recombinant Salmonella enteritidis PT4 plsY protein for structural studies?

For producing recombinant Salmonella enteritidis PT4 plsY protein, several expression systems can be employed, each with advantages for specific research purposes. Based on the available literature and characteristics of membrane proteins like plsY, the following approaches are recommended:

E. coli-based expression systems:

  • BL21(DE3) strains with pET vector systems offer high expression levels for structural studies

  • C41(DE3) or C43(DE3) strains are particularly suitable for membrane proteins like plsY, as they can accommodate the potentially toxic effects of overexpressing membrane proteins

  • Control of expression rate using lower temperatures (16-25°C) and reduced inducer concentrations can enhance proper folding

Purification strategies:

  • Affinity tags such as His6 or fusion partners can facilitate purification while maintaining protein activity

  • The specific tag type should be determined during the production process to optimize for protein stability and function

  • Membrane protein extraction requires careful optimization of detergents to maintain native conformation

For structural studies, it's essential to maintain the protein in a properly folded, active state. The recombinant plsY protein can be stored in a Tris-based buffer with 50% glycerol, as recommended in the product information . Extended storage should be at -20°C or -80°C, with working aliquots maintained at 4°C for up to one week to avoid freeze-thaw cycles that could compromise protein integrity .

What methods can be used to assess the enzymatic activity of recombinant Salmonella enteritidis PT4 plsY in vitro?

Several methods can be employed to assess the enzymatic activity of recombinant Salmonella enteritidis PT4 plsY:

Radiometric assays:

  • Using radiolabeled substrates (14C-glycerol-3-phosphate or 14C-acyl-ACP/acyl-CoA)

  • Measuring the incorporation of radiolabeled substrates into lysophosphatidic acid

  • Quantification through thin-layer chromatography (TLC) or scintillation counting

Coupled enzyme assays:

  • Linking plsY activity to other enzymatic reactions that produce detectable products

  • Monitoring the consumption of cofactors through spectrophotometric methods

HPLC-based methods:

  • Quantification of reaction products (lysophosphatidic acid) through high-performance liquid chromatography

  • Using mass spectrometry for precise identification and quantification of products

Fluorescence-based assays:

  • Employing fluorescently-labeled substrates

  • Monitoring changes in fluorescence upon substrate conversion

For optimal activity assessment, the reaction conditions should mimic the physiological environment with appropriate pH (typically 7.2-7.5), temperature (37°C), and ionic strength. The enzyme requires glycerol-3-phosphate and acyl-ACP (acyl carrier protein) as substrates, and the reaction buffer should include divalent cations (Mg2+ or Mn2+) as cofactors. The resulting lysophosphatidic acid can be detected and quantified using the methods mentioned above, providing insights into the kinetic parameters and catalytic efficiency of the recombinant plsY protein.

What strategies can be employed to study the membrane topology and integration of plsY in Salmonella enteritidis PT4?

Determining the membrane topology and integration of plsY requires specialized techniques that can reveal how this acyltransferase is oriented and embedded within the bacterial membrane:

Computational prediction methods:

  • Hydropathy analysis to identify potential transmembrane segments

  • Topology prediction algorithms (TMHMM, TOPCONS, HMMTOP) to generate initial models of membrane orientation

Experimental approaches:

  • Cysteine scanning mutagenesis combined with accessibility assays:

    • Introducing cysteine residues at various positions throughout the protein

    • Using membrane-impermeable sulfhydryl reagents to probe accessibility

    • Determining which regions are exposed to either side of the membrane

  • Reporter fusion techniques:

    • Creating fusion constructs with reporter proteins (e.g., GFP, alkaline phosphatase, β-lactamase)

    • The activity or fluorescence of the reporter indicates its cellular location

    • Systematically mapping the topology by creating fusions at different positions

  • Protease protection assays:

    • Treating membrane vesicles with proteases

    • Analyzing which regions of the protein are protected from digestion

    • Identifying domains located within the membrane or facing the protected side

  • Cryo-electron microscopy:

    • High-resolution structural determination of membrane proteins in near-native states

    • Revealing detailed interactions between the protein and the lipid bilayer

These techniques can provide complementary information about how plsY is integrated into the membrane, which is essential for understanding its function in phospholipid biosynthesis and potential interactions with other membrane components or pathogenicity factors in Salmonella enteritidis PT4.

How does plsY from Salmonella enteritidis PT4 compare with homologous proteins in other Salmonella serotypes and bacterial species?

Comparative analysis of plsY from Salmonella enteritidis PT4 with homologous proteins in other bacteria reveals important insights into its evolutionary conservation and functional significance:

Within Salmonella enterica serotypes:

  • plsY is highly conserved among different Salmonella enterica serotypes, including Typhimurium and Enteritidis strains

  • Comparison between Salmonella Enteritidis PT4 and PT34 shows minimal variation in the plsY gene sequence, despite these phage types having different plasmid profiles and virulence characteristics

  • The genomic analysis of Salmonella Enteritidis PT4 strain 578 in comparison with Salmonella Enteritidis ATCC 13076, Salmonella Typhimurium ATCC 13311, and Salmonella Typhimurium ATCC 14028 revealed that most unshared genes between these serotypes are related to metabolism, membrane proteins, and hypothetical proteins

Cross-species comparison:

  • The plsY protein belongs to a highly conserved family of acyltransferases found across diverse bacterial species

  • The catalytic mechanism and core structural features are preserved, reflecting the essential nature of phospholipid synthesis

  • Species-specific variations may occur in regions not directly involved in catalysis, potentially influencing substrate specificity or regulatory interactions

Functional conservation:

  • The essential role of plsY in bacterial phospholipid biosynthesis has led to strong selective pressure against major structural changes

  • The enzyme's function in the initial steps of membrane phospholipid synthesis is fundamental to bacterial cell viability across species

  • Variations in associated metabolic pathways may exist, reflecting adaptation to different ecological niches or host environments

What is the relationship between plsY expression and the formation of biofilms in Salmonella enteritidis PT4?

The relationship between plsY expression and biofilm formation in Salmonella enteritidis PT4 involves complex interactions between membrane phospholipid composition, cell surface properties, and regulatory networks:

Membrane composition influence on biofilm formation:

  • As a key enzyme in phospholipid biosynthesis, plsY affects membrane composition, which in turn influences cell surface hydrophobicity and charge

  • These surface properties are critical determinants of initial bacterial attachment to surfaces, the first step in biofilm formation

  • Alterations in membrane phospholipid profiles can affect the expression and function of surface adhesins involved in biofilm development

Relationship to rdar morphotype:

  • Interestingly, genomic analysis revealed that Salmonella Enteritidis PT4 strain 578 possesses the genetic requirements for the red, dry, and rough (rdar) morphotype but has lost this ability, as evidenced by its failure to form biofilm under evaluated conditions

  • The rdar morphotype is characterized by the production of cellulose and curli fimbriae, resulting in a distinctive colony appearance and enhanced biofilm formation

  • This phenotypic characterization showed differences among Salmonella Enteritidis PT4 578 and other serotypes regarding the expression of the rdar morphotype and biofilm formation

Regulatory connections:

  • Changes in membrane composition due to alterations in plsY expression or activity may influence signaling pathways that regulate biofilm formation

  • Stress responses triggered by membrane perturbations can activate or repress biofilm-associated genes

  • The connection between metabolism (including phospholipid synthesis) and virulence/biofilm formation is increasingly recognized in bacterial pathogens

While direct experimental evidence specifically linking plsY expression levels to biofilm formation in Salmonella enteritidis PT4 is limited in the provided references, the fundamental role of membrane composition in bacterial adhesion and community formation suggests a significant, albeit potentially indirect, relationship. Future studies specifically examining how modulation of plsY expression affects biofilm development would provide valuable insights into this connection.

How can CRISPR-Cas gene editing be applied to study plsY function in Salmonella enteritidis PT4 pathogenesis?

CRISPR-Cas gene editing provides powerful approaches for investigating plsY function in Salmonella enteritidis PT4 pathogenesis:

Genetic manipulation strategies:

  • Conditional knockdown systems:

    • Since plsY is likely essential, complete knockout may be lethal

    • Inducible promoters or CRISPRi (CRISPR interference) can allow controlled reduction of expression

    • Monitoring phenotypic changes under varying levels of plsY expression

  • Domain-specific mutations:

    • Targeted modifications of specific functional domains

    • Creating point mutations in catalytic sites or regulatory regions

    • Assessing the impact on enzymatic activity and virulence

  • Tag integration:

    • Adding epitope or fluorescent tags for protein localization studies

    • Monitoring protein dynamics during infection processes

Experimental applications:

  • Infection models: Evaluating how plsY modifications affect colonization, invasion, and persistence in cell culture and animal models

  • Stress response analysis: Testing how alterations in plsY affect bacterial survival under various stresses encountered during infection

  • Transcriptomic studies: Determining the effects of plsY modulation on global gene expression patterns

Relevant biological context:

  • Genome analysis of Salmonella Enteritidis PT4 strain 578 revealed the presence of two CRISPR systems (CRISPR 1 and CRISPR 2), both containing 29 bp with nine and eight unique spacers, respectively

  • These native CRISPR systems could potentially be utilized as part of the gene editing strategy

  • The efficiency of CRISPR-Cas editing in Salmonella can be enhanced by using counterselection markers and optimizing guide RNA design

When designing CRISPR-based studies of plsY, researchers should consider the potential polar effects on neighboring genes and implement appropriate controls to distinguish direct effects of plsY modification from secondary consequences. Additionally, complementation studies with wild-type plsY should be conducted to confirm phenotypic changes are specifically due to plsY alterations.

What roles might plsY play in Salmonella enteritidis PT4's adaptation to different environmental conditions encountered during infection?

Salmonella enteritidis PT4 encounters diverse environmental conditions during its infection cycle, and plsY likely plays crucial roles in adaptation to these changing environments:

Gastrointestinal transit and early infection:

  • During passage through the acidic stomach environment, membrane integrity is critical for survival

  • plsY-mediated phospholipid biosynthesis helps maintain membrane function under low pH stress

  • Changes in membrane fluidity through altered phospholipid composition can enhance resistance to bile salts encountered in the intestine

Intracellular survival:

  • After invasion of intestinal epithelial cells, Salmonella resides within a modified phagosome (Salmonella-containing vacuole, SCV)

  • plsY may contribute to membrane remodeling necessary for SCV formation and maintenance

  • Phospholipid composition affects the function of virulence factors, including the type III secretion systems (T3SS) that are crucial for intracellular survival

Temperature adaptation:

  • Transition from environmental temperatures to host body temperature (37°C) requires membrane fluidity adjustments

  • plsY activity might be regulated to modify phospholipid composition in response to temperature shifts

  • This adaptation is particularly relevant for foodborne pathogens like Salmonella Enteritidis PT4, which causes outbreaks linked to contaminated food sources, especially poultry products and eggs

Nutrient limitation responses:

  • Within host tissues, bacteria face restricted access to nutrients

  • plsY function may be integrated with metabolic regulatory networks to balance membrane synthesis with other cellular needs

  • Altering membrane composition may serve as a stress response mechanism during nutrient limitation

Connection to virulence expression:

  • Environmental cues often trigger virulence gene expression

  • Membrane composition can influence sensing of environmental signals and subsequent activation of virulence programs

  • The 12 Salmonella pathogenicity islands (SPIs) identified in Salmonella Enteritidis PT4 strain 578 contain genes whose expression and function may be indirectly influenced by plsY activity

Understanding how plsY activity is regulated in response to these environmental changes would provide insights into Salmonella's remarkable adaptability during the infection process. This knowledge could potentially reveal new approaches for intervention strategies targeting bacterial adaptation mechanisms.

How might inhibitors of plsY be developed as potential antimicrobial agents against Salmonella enteritidis PT4?

Development of plsY inhibitors as antimicrobial agents against Salmonella enteritidis PT4 represents a promising research direction, with several strategic approaches:

Rational drug design approaches:

  • Structure-based design:

    • Using computational modeling of plsY's active site to identify potential binding pockets

    • Virtual screening of compound libraries against these structural models

    • Fragment-based approaches to build inhibitors that specifically interact with catalytic residues

  • Substrate analog development:

    • Creating modified versions of natural substrates (glycerol-3-phosphate or acyl donor)

    • Designing non-hydrolyzable mimics that compete for binding but cannot undergo catalysis

    • Developing transition state analogs that bind with high affinity to the enzyme

  • Allosteric inhibitor discovery:

    • Targeting regulatory sites distant from the active site

    • Identifying compounds that lock the enzyme in an inactive conformation

    • Disrupting protein-protein interactions essential for enzyme function

Screening methodologies:

  • High-throughput screening using in vitro enzymatic assays

  • Whole-cell screening with reporter systems linked to membrane integrity

  • Phenotypic screening for compounds that specifically inhibit bacterial growth in a plsY-dependent manner

Considerations for antimicrobial development:

  • Selectivity: Designing inhibitors that specifically target bacterial plsY while minimizing effects on host lipid metabolism enzymes

  • Membrane permeability: Ensuring sufficient penetration through the bacterial outer membrane, particularly challenging for Gram-negative pathogens like Salmonella

  • Resistance development: Assessing the potential for resistance emergence and designing combination approaches to mitigate this risk

Therapeutic relevance:

  • Salmonella Enteritidis PT4 has caused global pandemics and remains a significant public health threat

  • The ongoing need for novel antimicrobials is highlighted by increasing resistance to conventional antibiotics

  • Targeting essential metabolic enzymes like plsY represents a strategy to develop new classes of antimicrobials with distinct mechanisms of action

Development of effective plsY inhibitors would require interdisciplinary collaboration between structural biologists, medicinal chemists, microbiologists, and clinicians to progress from initial hits to compounds with suitable properties for in vivo efficacy against Salmonella infections.

What are the optimal storage and handling conditions for maintaining the stability and activity of recombinant Salmonella enteritidis PT4 plsY protein?

Maintaining stability and activity of recombinant Salmonella enteritidis PT4 plsY protein requires careful attention to storage and handling conditions:

Storage conditions:

  • The recommended storage buffer is a Tris-based buffer with 50% glycerol, optimized for this specific protein

  • For short-term storage (up to one week), maintain working aliquots at 4°C

  • For standard storage, keep at -20°C

  • For extended storage periods, -80°C is recommended

Handling guidelines:

  • Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity

  • When working with the protein, maintain it on ice to minimize degradation

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Use low-binding microcentrifuge tubes to prevent protein adsorption to container surfaces

Stability considerations:

  • As a membrane protein, plsY may require the presence of appropriate detergents or lipid environments to maintain native conformation

  • Addition of reducing agents (such as DTT or β-mercaptoethanol) at low concentrations may help prevent oxidation of cysteine residues

  • Protease inhibitors can be included to prevent degradation by contaminating proteases

Activity preservation:

  • When assessing enzymatic activity, pre-warm buffers to the appropriate temperature before adding the enzyme

  • Prepare fresh substrate solutions to ensure maximal activity

  • Include appropriate cofactors required for enzymatic function

  • Consider the optimal pH range for activity when designing experimental buffers

By following these guidelines, researchers can maximize the stability and activity of recombinant Salmonella enteritidis PT4 plsY protein for various experimental applications, including structural studies, enzymatic assays, and inhibitor screening.

What experimental controls should be included when studying the role of plsY in Salmonella enteritidis PT4 virulence using animal infection models?

When investigating the role of plsY in Salmonella enteritidis PT4 virulence using animal infection models, comprehensive experimental controls are essential:

Genetic controls:

  • Wild-type control: Unmodified Salmonella enteritidis PT4 strain to establish baseline virulence

  • Complementation control: plsY-modified strains with plasmid-expressed wild-type plsY to verify phenotype restoration

  • Empty vector control: Modified strains carrying the empty vector backbone to account for effects of the vector itself

  • Known virulence mutant: Strain with mutation in a characterized virulence gene (e.g., in SPI-1 or SPI-2) as a positive control for attenuated virulence

Infection model controls:

  • Dose validation: Verification of actual bacterial numbers administered through retrospective plating

  • Mock-infected animals: Animals receiving vehicle only to establish baseline health parameters

  • Route-specific controls: Controls appropriate to the specific infection route (oral, intraperitoneal, etc.)

  • Timing controls: Sampling at multiple time points to capture the dynamic nature of infection

Analysis controls:

  • In vitro growth controls: Comparing growth rates of wild-type and modified strains in standard media

  • Tissue-specific controls: Analysis of bacterial loads in multiple organs to distinguish between invasion, dissemination, and persistence defects

  • Immune response controls: Monitoring host immune parameters to differentiate between direct virulence effects and altered immune recognition

  • Environmental stress controls: Evaluating bacterial survival under relevant stresses (acid, bile, oxidative stress) outside the animal model

Contextual considerations:

  • Previous studies on Salmonella Enteritidis PT4 have demonstrated its epidemiological significance and link to foodborne outbreaks, particularly from poultry products and eggs

  • The comprehensive genomic analysis of Salmonella Enteritidis PT4 strain 578 revealed multiple virulence determinants that should be considered when interpreting plsY-specific effects

  • The choice of animal model should reflect the natural host range and transmission patterns of Salmonella Enteritidis PT4

These controls help distinguish direct effects of plsY modification from secondary consequences and provide a comprehensive understanding of how changes in phospholipid biosynthesis impact various stages of the infection process.

How might systems biology approaches integrate plsY function with the broader metabolic and virulence networks in Salmonella enteritidis PT4?

Systems biology approaches offer powerful frameworks to understand how plsY function integrates with broader metabolic and virulence networks in Salmonella enteritidis PT4:

Multi-omics integration:

  • Transcriptomics: RNA-seq analysis under various conditions to identify genes co-regulated with plsY

  • Proteomics: Global protein expression profiling to detect changes in protein levels and post-translational modifications

  • Metabolomics: Comprehensive analysis of metabolite profiles to trace the impact of plsY activity on cellular metabolism

  • Lipidomics: Detailed characterization of membrane phospholipid composition and dynamics

Network analysis approaches:

  • Regulatory network reconstruction:

    • Identifying transcription factors controlling plsY expression

    • Mapping regulatory connections between metabolism and virulence gene expression

    • The genomic analysis of Salmonella Enteritidis PT4 strain 578 revealed 12 Salmonella pathogenicity islands (SPIs) , providing a framework for understanding virulence regulation

  • Metabolic modeling:

    • Constructing genome-scale metabolic models that incorporate phospholipid biosynthesis

    • Performing flux balance analysis to predict the effects of plsY perturbation

    • Simulating adaptation to different environmental conditions encountered during infection

  • Protein-protein interaction networks:

    • Identifying physical interactions between plsY and other proteins

    • Mapping functional connections within the membrane biosynthesis machinery

    • Discovering unexpected links to virulence systems

Integrative experimental strategies:

  • Conditional expression systems coupled with phenotypic assays:

    • Modulating plsY expression and measuring impacts across multiple phenotypes

    • Correlating changes in phospholipid synthesis with virulence traits

  • In vivo transcriptomics:

    • Analyzing gene expression during different stages of infection

    • Identifying condition-specific regulatory patterns

  • Mathematical modeling of infection dynamics:

    • Developing predictive models that incorporate metabolic adaptation

    • Simulating bacterial population dynamics under antimicrobial pressure

These systems biology approaches would provide a comprehensive understanding of how plsY function influences and is influenced by the complex networks controlling Salmonella enteritidis PT4 pathogenicity, potentially revealing new intervention strategies that target critical network nodes or edges.

What are the most promising research avenues for understanding the adaptation of Salmonella enteritidis PT4 plsY function in different host environments?

Several promising research avenues could enhance our understanding of how Salmonella enteritidis PT4 plsY function adapts to different host environments:

Host-specific adaptation studies:

  • Comparative analysis across host species:

    • Examining plsY expression and activity in Salmonella isolated from different hosts (humans, poultry, other animals)

    • Identifying potential host-specific adaptations in enzyme function or regulation

    • This is particularly relevant given that Salmonella Enteritidis PT4 is a generalist serotype that adapts to different hosts and transmission niches

  • In vivo expression profiling:

    • Using reporter constructs to monitor plsY expression during infection in different host tissues

    • Applying techniques like RNA-seq to infected tissues to capture bacterial transcriptional changes

    • Correlating plsY expression with specific stages of infection

Membrane adaptation mechanisms:

  • Phospholipid composition analysis:

    • Characterizing changes in membrane phospholipid profiles during adaptation to different host environments

    • Correlating these changes with plsY activity and expression levels

    • Investigating the role of membrane remodeling in evading host immune responses

  • Regulatory network identification:

    • Mapping the signaling pathways that modulate plsY expression in response to environmental cues

    • Identifying host-derived signals that trigger changes in phospholipid metabolism

    • Understanding how these regulatory networks integrate with virulence expression

Innovative methodological approaches:

  • Single-cell techniques:

    • Applying single-cell RNA-seq to capture heterogeneity in bacterial populations during infection

    • Using fluorescent reporters to visualize plsY expression dynamics at the single-cell level

    • Correlating expression patterns with bacterial cell fates in the host

  • Organoid infection models:

    • Using human or animal intestinal organoids to study bacterial adaptation in more physiologically relevant conditions

    • Examining tissue-specific effects on bacterial membrane composition

    • Testing how plsY function contributes to colonization of different intestinal regions

  • CRISPR-based screening:

    • Applying genome-wide CRISPR screens to identify genes that synthetic lethal or synthetic sick interactions with plsY

    • Discovering condition-specific genetic interactions relevant to host adaptation

These research avenues would provide insights into how Salmonella enteritidis PT4 adapts its membrane physiology, through plsY function, to thrive in diverse host environments, potentially revealing new targets for intervention strategies that disrupt these adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.