Recombinant Salmonella enteritidis PT4 Large-conductance mechanosensitive channel (mscL)

What is the structure and function of Salmonella enteritidis PT4 mscL protein?

The Large-conductance mechanosensitive channel (mscL) from Salmonella enteritidis PT4 is a 137-amino acid membrane protein that functions as a pressure-relief valve, protecting bacterial cells from osmotic shock. The full amino acid sequence of this protein is: MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFTLREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEEVLLGEIRDLLKEQNNRS . The protein forms a homopentameric channel in the bacterial cell membrane that opens in response to increased membrane tension, allowing the release of cytoplasmic solutes and preventing cell lysis during hypoosmotic stress.

How does recombinant mscL protein differ from native mscL?

Recombinant mscL protein from Salmonella enteritidis PT4 is typically produced with additional features to facilitate purification and analysis. The recombinant version referenced in the available research includes an N-terminal His-tag for purification purposes . While the core protein structure remains similar to the native form, the presence of these tags may subtly alter protein behavior in some experimental contexts. Researchers should consider whether tag removal is necessary for their specific applications, particularly for functional studies where the tag might interfere with channel activity or protein-protein interactions.

What expression systems are used for producing recombinant Salmonella enteritidis PT4 mscL?

Recombinant Salmonella enteritidis PT4 mscL protein is typically expressed in E. coli expression systems . The protein can be produced using vectors such as pET series that allow for controlled induction of protein expression. The full-length protein (amino acids 1-137) with an N-terminal His-tag can be successfully expressed and purified from E. coli, yielding protein with greater than 90% purity as determined by SDS-PAGE . This approach is analogous to expression systems used for other Salmonella recombinant proteins, such as InvH, which has been successfully expressed in E. coli BL21(DE3) using the pET303 vector system .

What are the recommended protocols for reconstitution and storage of purified recombinant mscL protein?

For optimal handling of recombinant mscL protein:

• Reconstitution: Centrifuge the vial briefly prior to opening to bring contents to the bottom. Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

• Storage preparation: Add glycerol to a final concentration of 5-50% (50% is standard) and aliquot for long-term storage .

• Storage conditions: Store reconstituted protein at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles. Working aliquots may be stored at 4°C for up to one week .

• Freeze-thaw sensitivity: Repeated freezing and thawing significantly reduces protein activity and should be avoided .

The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution .

How can researchers validate the functionality of recombinant mscL channels in vitro?

Researchers can employ several complementary approaches to validate recombinant mscL functionality:

• Electrophysiology: Patch-clamp recording after reconstitution into liposomes or planar lipid bilayers can directly measure channel conductance and gating in response to membrane tension.

• Fluorescence-based assays: Reconstituting mscL into liposomes loaded with fluorescent dyes that are released upon channel opening provides a high-throughput method to assess functionality.

• Structural integrity assessment: Circular dichroism spectroscopy can confirm proper protein folding by analyzing secondary structure elements.

• Osmotic shock assays: Functionally complementing an mscL-deficient bacterial strain with the recombinant protein and testing survival under hypoosmotic shock conditions demonstrates in vivo functionality.

These methods can be adapted from protocols used for similar membrane proteins, with consideration for the specific properties of Salmonella enteritidis PT4 mscL.

What are the critical considerations for designing immunological studies using recombinant Salmonella enteritidis PT4 mscL?

When designing immunological studies with recombinant mscL:

• Antigen preparation: Ensure protein purity exceeds 90% via SDS-PAGE validation to minimize non-specific immune responses .

• Adjuvant selection: Consider adjuvant compatibility with membrane proteins. Lessons from studies with other Salmonella recombinant proteins suggest Freund's Complete Adjuvant (FCA) can be effective for initial immunization .

• Immunization schedule: Design protocols with primary immunization followed by boosters at 14-day intervals, similar to successful approaches with other Salmonella recombinant proteins .

• Cross-reactivity analysis: Include controls to assess potential cross-reactivity with homologous proteins from other pathogens or host proteins.

• Antibody validation: Validate antibody specificity using Western blotting and ELISA against both recombinant and native forms of the protein.

Drawing from immunization protocols used with other Salmonella recombinant proteins, researchers should monitor antibody titers through indirect ELISA at regular intervals (e.g., every 7 days up to day 42) to assess response stability .

How can recombinant mscL be utilized in structural biology studies?

Recombinant Salmonella enteritidis PT4 mscL protein can advance structural biology through:

• X-ray crystallography: The high-purity recombinant protein (>90%) provides starting material for crystallization trials. Researchers should optimize detergent selection for membrane protein crystallization and consider using antibody fragments to stabilize the protein in specific conformations.

• Cryo-electron microscopy: The pentameric structure of mscL (approximately 68 kDa) is suitable for cryo-EM analysis, potentially revealing conformational states during channel gating.

• NMR spectroscopy: For dynamic studies, isotopically labeled recombinant protein can be produced by expressing the protein in E. coli grown in media containing 15N or 13C sources.

• Molecular dynamics simulations: Experimental structures can inform computational models to simulate channel behavior under membrane tension, with the complete amino acid sequence available for accurate modeling .

• Site-directed spin labeling and EPR spectroscopy: Strategic introduction of cysteine residues allows for spin labeling to monitor conformational changes during channel gating.

What approaches can be used to study mscL interactions with antimicrobial compounds?

To investigate mscL-antimicrobial interactions:

• Binding assays: Isothermal titration calorimetry or surface plasmon resonance can quantify binding affinities between purified recombinant mscL and antimicrobial compounds.

• Functional modulation screening: Electrophysiological methods can identify compounds that alter channel gating properties, potentially revealing new antimicrobial mechanisms.

• In silico docking: Computational screening using structural models based on the known amino acid sequence can predict binding sites and interactions .

• Resistance studies: Comparing antimicrobial susceptibility in strains expressing wild-type versus modified mscL channels can reveal the channel's role in antimicrobial resistance.

• Fluorescence-based high-throughput screening: Modified versions of fluorescence-based functionality assays can be adapted to screen compound libraries for mscL modulators.

This research direction is particularly relevant given the emerging interest in bacterial mechanosensitive channels as antimicrobial targets.

How does Salmonella enteritidis PT4 mscL compare to homologous proteins in other Salmonella serovars and bacterial species?

Comparative analysis of mscL across species provides evolutionary and functional insights:

• Sequence conservation: Alignment of the Salmonella enteritidis PT4 mscL sequence with homologs from other Salmonella serovars reveals conserved functional domains and strain-specific variations.

• Functional differences: Electrophysiological comparison of recombinant channels from different species can identify differences in gating thresholds, conductance, and ion selectivity.

• Genomic context analysis: Comparative genomic approaches similar to those used in studying Salmonella Enteritidis PT4 and Salmonella Gallinarum can reveal evolutionary relationships and adaptations of mscL genes.

• Host-specificity correlations: Analysis of mscL sequence variations across host-specific versus generalist Salmonella serovars may reveal adaptive patterns.

• Structural comparisons: Homology modeling based on known mscL structures from other bacteria (e.g., M. tuberculosis or E. coli) can highlight structural differences that may relate to functional adaptations.

What are common challenges in expressing and purifying functional recombinant mscL protein?

Researchers working with recombinant mscL protein frequently encounter these challenges:

• Protein aggregation: As a membrane protein, mscL has hydrophobic regions that can cause aggregation. Optimize detergent types and concentrations during purification, and consider using chaotropic agents like urea for initial solubilization .

• Low expression yields: Membrane protein toxicity can limit expression. Use tightly controlled induction systems and optimize induction conditions (temperature, inducer concentration, duration).

• Protein misfolding: Improper folding can occur during recombinant expression. Consider using specialized E. coli strains designed for membrane protein expression or lower expression temperatures.

• Contaminating proteins: Achieving >90% purity requires optimized purification protocols . Consider multiple purification steps, such as combining His-tag affinity chromatography with size exclusion or ion exchange chromatography.

• Loss of activity during purification: Maintain appropriate detergent concentrations throughout purification and storage to preserve the native conformation and functionality.

How can researchers address inconsistent results in functional assays with recombinant mscL?

When facing variability in functional assays:

• Quality control measures: Implement routine purity analysis by SDS-PAGE and activity benchmarking before experimental use.

• Storage consistency: Standardize buffer conditions, protein concentration, and storage duration to minimize batch-to-batch variation .

• Lipid environment control: For reconstitution experiments, maintain consistent lipid composition and protein-to-lipid ratios, as these factors significantly affect channel behavior.

• Temperature and pH standardization: Maintain consistent experimental conditions, as mechanosensitive channel properties are sensitive to environmental parameters.

• Protein age monitoring: Track time since reconstitution and establish validation criteria for aged protein, as functionality may decrease over time even with proper storage .

• Protocol standardization: Develop detailed standard operating procedures for reconstitution and functional assays to ensure reproducibility across experiments and personnel.

What controls should be included in mscL functional studies to ensure valid interpretation of results?

Essential controls for mscL functional studies include:

• Negative controls:

  • Heat-denatured protein to confirm that observed effects require functional protein

  • Empty liposomes (without mscL) to establish baseline measurements

  • Appropriate buffer-only controls

• Positive controls:

  • Well-characterized mechanosensitive channel activators or modulators

  • Alternative mechanosensitive channel (e.g., MscS) with distinct properties for comparison

• Validation controls:

  • Wild-type versus site-directed mutants with known altered function

  • Dose-response relationships for membrane tension or modulatory compounds

  • Parallel assays using different methodological approaches for cross-validation

• Specificity controls:

  • Pharmacological blockers specific to mscL

  • Antibody-based inhibition to confirm effects are protein-specific

What potential does recombinant Salmonella enteritidis PT4 mscL hold for vaccine development?

While mscL itself has not been extensively explored as a vaccine candidate, insights from other Salmonella recombinant protein vaccines suggest several research directions:

• Antigen potential evaluation: Studies with other Salmonella recombinant proteins, such as InvH, have demonstrated strong immune responses in animal models . Similar immunogenicity studies could assess mscL's potential as a vaccine antigen.

• Adjuvant optimization: Research with recombinant InvH protein showed that adjuvant selection (e.g., Freund's Complete Adjuvant) significantly impacts vaccine efficacy . Similar optimization would be necessary for mscL-based vaccines.

• Cross-protection analysis: InvH-based vaccines provided protection against homologous and heterologous Salmonella serovars . Research could determine if mscL's conservation across serovars could similarly provide broad protection.

• Delivery system development: The full amino acid sequence of mscL could be analyzed for immunogenic epitopes that might be incorporated into subunit or peptide vaccines.

• Combination vaccine approaches: Given that single-antigen vaccines may provide incomplete protection, studies could explore combining mscL with other Salmonella antigens for enhanced efficacy.

How might recombinant mscL be utilized in development of novel antimicrobial strategies?

Recombinant mscL presents several opportunities for antimicrobial development:

• Drug target validation: Purified recombinant mscL enables high-throughput screening for compounds that modulate channel activity, potentially identifying molecules that cause inappropriate channel opening and bacterial lysis.

• Peptide inhibitor design: The known amino acid sequence allows for rational design of peptides that might interfere with channel assembly or function.

• Channel-mediated delivery systems: Compounds that trigger mscL opening could be combined with antibiotics too large to normally enter bacterial cells, creating synergistic antimicrobial effects.

• Resistance mechanism studies: Investigating how mutations in mscL affect antimicrobial susceptibility could reveal novel resistance mechanisms and inform drug development strategies.

• Species-specific targeting: Comparative analysis of mscL across bacterial species could identify structural or functional differences that enable development of species-selective antimicrobials.

What role might mscL play in bacterial adaptation to environmental stresses beyond osmotic shock?

Investigations into broader mscL functions could explore:

• Antibiotic resistance: Mechanosensitive channels may contribute to intrinsic antibiotic resistance by responding to membrane perturbations caused by antimicrobial compounds.

• Biofilm formation: Changes in mechanical forces during biofilm development may influence mscL activity, potentially affecting biofilm structural properties and antimicrobial resistance.

• Host colonization dynamics: During infection, bacteria encounter various mechanical and osmotic stresses. Understanding how mscL contributes to adaptation in host environments could reveal new aspects of Salmonella pathogenesis.

• Temperature adaptation: Membrane fluidity changes with temperature affect mechanical properties, potentially altering mscL gating thresholds during host infection or environmental transitions.

• Genetic regulation networks: Research could explore how mscL expression integrates with other stress response systems in Salmonella, building on comparative genomic approaches used for other Salmonella serovars .

Properties of Recombinant Salmonella enteritidis PT4 mscL Protein

This table provides essential technical information for researchers planning experiments with recombinant Salmonella enteritidis PT4 mscL protein, summarizing the key parameters necessary for proper handling and experimental design.