Recombinant Salmonella enteritidis PT4 NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
nuoA; SEN2310; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.
Database Links

KEGG: set:SEN2310

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Salmonella enteritidis PT4?

NADH-quinone oxidoreductase (also known as Complex I) plays a critical role in the bacterial respiratory chain by catalyzing electron transfer from NADH to ubiquinone, coupled with ion translocation across the membrane. This process is essential for energy generation in Salmonella enteritidis PT4. Similar to other bacterial NADH oxidoreductases, such as Na+-NQR found in Vibrio species, this enzyme complex facilitates electron transfer in the respiratory chain . The subunit A (nuoA) represents one component of this multi-subunit complex that is crucial for proper assembly and function of the entire enzyme.

How does NADH-quinone oxidoreductase differ between Salmonella and other bacteria?

While many bacteria possess NADH-quinone oxidoreductases, there are significant variations in structure and function. For instance, some bacteria like Vibrio harveyi utilize Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) that couples electron transfer with Na+ translocation rather than H+ translocation . Salmonella enteritidis PT4 possesses a proton-translocating NADH:quinone oxidoreductase system similar to that found in many other enterobacteria. The nuoA subunit in Salmonella enteritidis PT4 contributes to the assembly and membrane anchoring of the complex, while its specific amino acid sequence contains unique features compared to other bacterial species.

What experimental approaches are commonly used to study recombinant nuoA expression?

To study recombinant nuoA expression, researchers commonly employ molecular cloning techniques to isolate the nuoA gene from Salmonella enteritidis PT4 genomic DNA. Similar to approaches used for Na+-NQR studies in Vibrio harveyi, this typically involves:

  • PCR amplification of the nuoA gene with appropriate restriction enzyme sites

  • Cloning into expression vectors such as pBAD or pET-based systems

  • Expression in heterologous hosts like E. coli

  • Purification using affinity tags (His-tag, GST)

  • Verification through activity assays such as NADH oxidase activity measurements

Expression systems must be carefully designed to ensure proper maturation of the protein, as seen in related bacterial oxidoreductase systems that require specific maturation factors for functional assembly .

What experimental design considerations are crucial when studying nuoA function?

When designing experiments to study nuoA function, researchers should consider:

The table below illustrates typical activity measurements that could be applied to nuoA-containing complexes, based on measurements used for related oxidoreductases:

ConditionNADH Oxidase Activity (nmol·min⁻¹·mg⁻¹)dNADH:quinone Oxidoreductase Activity (nmol·min⁻¹·mg⁻¹)Comments
Wild-type800-900240-260Baseline activity
nuoA mutant<5<50Significant reduction
Complemented mutant750-850220-240Restoration of activity
With specific inhibitor<10230-250Confirms specificity

How can researchers effectively analyze data from nuoA expression experiments?

Effective data analysis for nuoA expression experiments requires:

  • Unsupervised Data Analysis Methods: Apply techniques such as hierarchical clustering, k-means clustering, or principal component analysis to explore expression patterns without bias .

  • Statistical Validation: Implement proper statistical approaches to determine significance of observed differences, accounting for biological and technical variation.

  • Normalization Procedures: Normalize data appropriately to account for technical variables such as sample preparation differences or batch effects.

  • Integration of Multiple Data Types: Combine results from different assay types (e.g., enzyme activity, protein quantification, gene expression) to build a comprehensive understanding of nuoA function.

As noted in toxicogenomic studies, critical assessment of results is essential as clustering patterns can sometimes reflect technical factors rather than biological significance .

What are the key challenges in purifying functional recombinant nuoA protein?

Purifying functional recombinant nuoA presents several challenges:

  • Membrane Association: As a component of a membrane-bound complex, nuoA is hydrophobic and requires detergent solubilization, which can affect protein stability and activity.

  • Complex Assembly Dependencies: Similar to Na+-NQR complexes, functional assembly may require additional maturation factors or chaperones not present in heterologous expression systems .

  • Post-translational Modifications: Functional activity may depend on specific post-translational modifications that occur only in the native host.

  • Stability Issues: Once removed from the complete complex, individual subunits like nuoA may exhibit reduced stability.

  • Activity Assessment: Since nuoA functions as part of a multi-subunit complex, assessing its individual contribution to activity requires specialized approaches.

These challenges parallel those observed with Na+-NQR, where expression of the operon alone was insufficient for producing functional enzyme in E. coli, requiring additional maturation factors for complete assembly .

How do mutations in conserved residues of nuoA affect complex assembly and function?

Mutations in conserved residues of nuoA can significantly impact complex assembly and function, similar to observations in related bacterial oxidoreductases. Research approaches to study these effects include:

  • Site-directed Mutagenesis: Target conserved residues (particularly cysteine residues if present, as seen in NqrM) to assess their role in complex assembly and electron transfer.

  • Structural Analysis: Use techniques like cryo-EM or X-ray crystallography to determine how mutations alter protein conformation.

  • Activity Correlation: Correlate structural changes with functional outcomes using activity assays.

In related systems like Na+-NQR, mutation of a single conserved cysteine residue (Cys33 in V. harveyi NqrM) completely prevented enzyme maturation, while mutations in other cysteine residues only decreased the yield of mature protein . Similar critical residues likely exist in nuoA that are essential for proper folding, assembly, or function of the complex.

What role does nuoA play in the pathogenesis of Salmonella enteritidis PT4?

The role of nuoA in Salmonella pathogenesis involves several aspects:

  • Energy Production: As part of the respiratory complex, nuoA contributes to ATP generation needed during infection.

  • Survival in Host Environment: The respiratory chain helps Salmonella adapt to changing oxygen availability and redox conditions within host tissues.

  • Virulence Factor Expression: Metabolic state influences expression of virulence factors.

  • Host Immune Response: Changes in bacterial membrane components can affect recognition by host immune system.

Since Salmonella infection causes intestinal symptoms including diarrhea, fever, and abdominal cramps , understanding how respiratory chain components like nuoA contribute to bacterial survival during infection could reveal new therapeutic targets. Research methodologies to explore this connection include:

  • Infection Models: Compare virulence of wild-type and nuoA mutant strains in cell culture and animal models.

  • Transcriptomic Analysis: Assess how nuoA deletion affects expression of virulence genes.

  • Metabolic Profiling: Determine how altered respiratory function impacts pathogen metabolism during infection.

How do environmental factors influence nuoA expression and function in Salmonella?

Environmental factors significantly impact nuoA expression and function in Salmonella through complex regulatory networks. Research approaches to investigate these relationships include:

  • Transcriptional Analysis: Using RNA-seq or qPCR to quantify nuoA expression under various conditions.

  • Reporter Systems: Constructing promoter-reporter fusions to visualize expression patterns.

  • Proteomic Analysis: Quantifying protein levels in response to environmental changes.

  • Functional Assays: Measuring NADH oxidase activity under different conditions.

Key environmental factors to consider include:

  • Oxygen Availability: Oxygen concentration directly affects respiratory chain requirements.

  • Carbon Source: Different carbon sources alter electron flow through the respiratory chain.

  • pH: Gastric acidity and intestinal pH variations influence expression patterns.

  • Temperature: Host body temperature (37°C) versus environmental temperature.

  • Antimicrobial Compounds: Exposure to host defense molecules or antibiotics.

What techniques are available for investigating protein-protein interactions involving nuoA?

Several techniques can be employed to study protein-protein interactions involving nuoA:

  • Bacterial Two-Hybrid Systems: Useful for screening potential interaction partners.

  • Co-immunoprecipitation: Allows isolation of protein complexes containing nuoA using specific antibodies.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify proteins in close proximity to nuoA.

  • Blue Native PAGE: Preserves native protein complexes for analysis of complex integrity in wild-type versus mutant strains.

  • FRET Analysis: If fluorescent tags can be incorporated without disrupting function, Förster resonance energy transfer can reveal dynamic interactions.

  • Surface Plasmon Resonance: For quantitative assessment of binding kinetics between purified components.

When designing such experiments, it's crucial to consider how membrane association affects these interactions, as seen in Na+-NQR complex studies where isolated complexes from mutant strains lacked several subunits .

How can researchers accurately measure electron transfer activity in recombinant nuoA-containing complexes?

Accurate measurement of electron transfer activity requires specialized approaches:

  • Membrane Vesicle Preparation: Isolate bacterial membrane vesicles containing the intact respiratory complex.

  • Spectrophotometric Assays: Monitor NADH oxidation by following absorbance decrease at 340 nm.

  • Oxygen Consumption Measurements: Use oxygen electrodes to measure respiratory activity.

  • Artificial Electron Acceptors: Employ compounds like menadione or ferricyanide as electron acceptors in activity assays .

  • Inhibitor Studies: Use specific inhibitors to distinguish complex I activity from other NADH-oxidizing enzymes.

A typical experimental approach would include:

  • Preparing membrane vesicles from cells expressing recombinant nuoA

  • Measuring NADH oxidase activity in the presence and absence of specific inhibitors

  • Comparing activities between wild-type and mutant forms

  • Calculating specific activity normalized to protein content

The table below illustrates a methodological approach to activity measurement, based on techniques used for related oxidoreductases:

MeasurementSubstrateAcceptorInhibitorDetection MethodExpected Activity Range
NADH oxidaseNADHO₂-Absorbance at 340 nm700-900 nmol·min⁻¹·mg⁻¹
NADH:quinone activityNADHUbiquinone-Absorbance at 340 nm200-300 nmol·min⁻¹·mg⁻¹
Specific Complex I activityNADHUbiquinoneAntimycin AAbsorbance at 340 nm150-250 nmol·min⁻¹·mg⁻¹
Na⁺-dependencyNADHUbiquinone-ΔActivity with/without Na⁺50-100 nmol·min⁻¹·mg⁻¹

What data analysis approaches can resolve contradictory results in nuoA research?

When faced with contradictory results in nuoA research, several analytical approaches can help resolve discrepancies:

  • Meta-analysis: Systematically review and analyze existing data across multiple studies to identify patterns and sources of variation.

  • Batch Effect Analysis: Assess whether discrepancies stem from experimental batch effects rather than biological differences.

  • Cross-validation: Apply different analytical methods to the same dataset to determine if contradictions are method-dependent.

  • Multifactorial Analysis: Examine how multiple variables may interact to produce apparently contradictory outcomes.

  • Reproducibility Assessment: Implement standardized protocols across different laboratories to evaluate reproducibility.

As noted in toxicogenomics research, "adhering to standard laboratory practices and carefully analyzing data can lead to high-quality, reproducible results that reflect the biology of the system" . Creating a database that captures experimental conditions, genetic backgrounds, and phenotypic outcomes would allow more effective comparison across studies .

What are the future research directions for Salmonella enteritidis PT4 nuoA studies?

Future research on Salmonella enteritidis PT4 nuoA should focus on:

  • Structural Characterization: Determining high-resolution structures of nuoA within the complete complex.

  • Regulatory Networks: Elucidating how expression is regulated during different phases of infection.

  • Host-Pathogen Interactions: Investigating how nuoA activity affects host cellular responses.

  • Comparative Analysis: Examining differences between nuoA function in Salmonella versus other pathogens.

  • Novel Therapeutics: Exploring potential for targeting nuoA or its interactions as antimicrobial strategies.

  • System-Level Integration: Incorporating nuoA function into comprehensive models of Salmonella metabolism and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.