What is the basic structure and amino acid sequence of Salmonella enteritidis PT4 nuoK?

The nuoK subunit (UniProt ID: B5R300) from Salmonella enteritidis PT4 is a small, hydrophobic membrane protein consisting of 100 amino acids. Its sequence is: MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG . The protein contains multiple transmembrane domains with hydrophobic stretches typical of integral membrane proteins in the respiratory chain complex. Structural analysis indicates that nuoK is positioned within the membrane domain of the NADH:quinone oxidoreductase complex, contributing to the formation of proton translocation channels essential for energy conservation.

What are the optimal methodologies for expressing and purifying recombinant Salmonella enteritidis PT4 nuoK?

Expression System Selection:
The expression of membrane proteins like nuoK presents significant challenges due to their hydrophobicity. A systematic approach using E. coli BL21(DE3) with specialized vectors containing strong inducible promoters (T7 or tac) has proven effective. The inclusion of fusion tags (particularly His6 or MBP) at the N-terminus facilitates detection and purification while minimizing disruption of membrane insertion.

Optimized Purification Protocol:

• Culture growth at lower temperatures (16-18°C) after induction increases proper folding

• Membrane fraction isolation through differential centrifugation

• Solubilization using mild detergents (preferred detergents in table below)

• Purification via affinity chromatography followed by size exclusion chromatography

Table 1: Detergent Effectiveness for nuoK Solubilization

When expressing recombinant nuoK, maintaining the protein in 50 mM Tris buffer (pH 7.5) with 150 mM NaCl, 5% glycerol, and 0.05% DDM provides optimal stability . Yield can be improved by using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

What spectroscopic techniques are most informative for studying nuoK structure and interactions?

Advanced Spectroscopic Approaches for nuoK Analysis:

For structural characterization of nuoK and its interactions within the respiratory complex, multiple complementary spectroscopic techniques provide crucial insights:

• Circular Dichroism (CD) Spectroscopy: Particularly effective for assessing secondary structure content and folding status of purified nuoK. Far-UV CD spectra (190-250 nm) reveal the predominantly α-helical nature of nuoK, with characteristic minima at 208 nm and 222 nm. Thermal stability studies using CD show that nuoK maintains structural integrity up to 60°C in appropriate detergent environments.

• Fluorescence Spectroscopy: While nuoK lacks tryptophan residues, introduced tryptophan mutations at strategic positions can serve as intrinsic fluorescent probes. Binding studies using fluorescently labeled quinones have demonstrated direct interaction between nuoK and electron carriers, with dissociation constants in the micromolar range.

• EPR Spectroscopy: Particularly valuable for examining the interaction of nuoK with iron-sulfur clusters in adjacent subunits. Site-directed spin labeling of specific residues in nuoK can provide distance constraints and conformational information.

• FTIR Spectroscopy: Reveals detailed information about protonation states of key residues involved in proton translocation. Difference FTIR spectroscopy has identified vibrational changes associated with quinone binding and electron transfer events .

For advanced structural analysis, a combination of cryoEM and cross-linking mass spectrometry has proven most effective in elucidating the position and interactions of nuoK within the complete respiratory complex.

How can site-directed mutagenesis be optimized for studying nuoK function?

Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationships of nuoK. Based on studies with E. coli homologs, a systematic mutagenesis strategy should target:

• Conserved charged residues: Particularly glutamic acid residues (corresponding to E36 and E72 in E. coli) which are critical for proton translocation. These residues should be mutated to both neutral (Gln, Asn) and oppositely charged (Lys, Arg) alternatives to distinguish between proton transport and structural roles .

• Transmembrane interfacial residues: Mutations at the membrane-cytosol interface can reveal important determinants of protein stability and assembly.

• Residues implicated in quinone binding: Strategic mutations affecting the predicted quinone-binding region can help delineate the electron transfer pathway.

Methodological Considerations:

For optimal results, employ a two-stage PCR approach using complementary mutagenic primers with 15-20 nucleotide overlaps flanking the mutation site. Following mutagenesis, expression levels should be verified by immunoblotting against either the native protein or an incorporated tag. Functional assessment requires reconstitution of the mutant protein into proteoliposomes for measuring proton translocation activity using pH-sensitive fluorophores.

The most informative mutations in homologous systems have been E36Q and E72Q, which maintain complex assembly but severely impair proton translocation, indicating direct roles in the proton pumping mechanism .

How do specific mutations in conserved nuoK residues affect Complex I function?

Studies on E. coli's homologous NuoK (ND4L) have revealed critical functional roles for specific conserved residues. Mutations in membrane-embedded acidic residues, particularly glutamic acid residues, have profound effects on enzyme function:

• E36 Mutations: Conversion of the nearly perfectly conserved glutamic acid at position 36 to glutamine (E36Q) or other amino acids results in almost complete loss of coupled electron transfer activity while maintaining complex assembly. This mutation severely impairs proton translocation without affecting NADH dehydrogenase activity, demonstrating its specific role in the proton pumping mechanism .

• E72 Mutations: The highly conserved glutamic acid at position 72, when mutated to glutamine (E72Q), causes significant reduction in coupled activities. This indicates that both membrane-embedded acidic residues are crucial for the proton translocation mechanism of Complex I .

• Arginine Mutations: Mutations of arginine residues located on the cytosolic loops (particularly double mutations of vicinal arginines) severely impair coupled activities. These positively charged residues likely play important roles in maintaining proper protein conformation or in interactions with other subunits .

Table 2: Functional Impact of Key nuoK Mutations

These findings suggest that the conserved glutamic acid residues in nuoK are integral to the coupling mechanism that links electron transfer to proton translocation in Complex I.

How can suppressor mutations inform our understanding of nuoK function in respiratory chains?

Suppressor mutations provide valuable insights into the functional interdependence of nuoK with other components of the respiratory chain. Studies in Salmonella have identified suppressor mutations that partially restore respiratory function in strains with defective quinone biosynthesis:

Genome sequencing of suppressor mutants derived from ubiquinone-deficient (ΔubiA) Salmonella strains revealed compensatory mutations in several NADH:quinone oxidoreductase subunits, including nuoG (Q297K), nuoM (A254S), and nuoN (A444E) . These mutations improved electron flow from NADH to alternative quinones (demethylmenaquinone and menaquinone) under certain growth conditions.

The functional rescue provided by these suppressor mutations demonstrates:

• The adaptability of NADH:quinone oxidoreductase to utilize alternative electron acceptors

• The structural and functional interdependence between nuoK and other subunits (particularly nuoM and nuoN)

• The existence of conformational changes that can alter quinone binding specificity

These findings suggest that nuoK functions within a highly coordinated membrane domain where subtle structural alterations in one subunit can compensate for deficiencies in electron transport components. This has significant implications for understanding the evolution of respiratory chains and their adaptation to different electron carriers.

What techniques are most effective for assessing the impact of nuoK mutations on proton translocation?

Evaluating the effects of nuoK mutations on proton translocation requires specialized techniques that can directly measure proton movement across membranes:

1. Inverted Membrane Vesicle Assays:
Preparation of inverted membrane vesicles from cells expressing wild-type or mutant nuoK allows direct measurement of proton pumping. The NADH-driven quenching of acridine orange or ACMA fluorescence provides quantitative data on proton translocation efficiency. This approach has revealed that E36 mutations severely impair proton translocation while preserving complex assembly .

2. Reconstituted Proteoliposome Systems:
Purified Complex I containing wild-type or mutant nuoK can be reconstituted into proteoliposomes with co-incorporated pH-sensitive fluorescent dyes. This system allows precise control over experimental conditions and can distinguish substrate oxidation from proton pumping activities.

3. Whole-Cell Bioenergetic Analysis:
Oxygen consumption measurements coupled with membrane potential determination using fluorescent dyes (e.g., DiSC3(5)) provide insights into the bioenergetic consequences of nuoK mutations in intact cells.

4. Electrical Measurements using Solid-Supported Membrane Electrophysiology:
This advanced technique directly measures charge translocation across membranes containing reconstituted Complex I, providing high temporal resolution of the proton pumping process.

5. Hydrogen/Deuterium Exchange Mass Spectrometry:
This approach identifies conformational changes and solvent accessibility alterations resulting from mutations, offering insights into how specific residues contribute to the proton translocation mechanism.

These complementary approaches have collectively established that conserved glutamic acid residues in nuoK are directly involved in proton translocation rather than merely maintaining structural integrity or electron transfer capability.

How does nuoK contribute to quinone specificity in bacterial respiratory chains?

NuoK plays a significant role in determining the quinone specificity of NADH:quinone oxidoreductase, albeit indirectly through its structural contributions to the membrane domain. Research on Salmonella respiratory mutants has provided valuable insights:

In wild-type Salmonella, the primary quinone utilized under aerobic conditions is ubiquinone, while demethylmenaquinone and menaquinone serve as alternative electron carriers during anaerobic respiration . Studies of ubiquinone biosynthesis mutants (ΔubiA and ΔubiE) revealed that suppressor mutations in Complex I subunits, including those proximal to nuoK (nuoM and nuoN), can enhance the enzyme's ability to utilize alternative quinones.

The proximity of nuoK to the proposed quinone-binding site suggests that its membrane-embedded residues contribute to the architecture of the quinone-binding pocket. Specifically:

• Conformational changes transmitted through nuoK may influence the accessibility and binding affinity for different quinone species

• The hydrophobic environment created by nuoK's transmembrane helices helps establish the correct positioning of quinones for efficient electron transfer

• Interactions between nuoK and adjacent subunits (particularly nuoM and nuoN) shape the quinone-binding site, affecting quinone specificity

This understanding of nuoK's role in quinone interactions has important implications for engineering bacterial respiratory chains with altered specificity for biotechnological applications.

How does the function of nuoK differ between aerobic and anaerobic respiratory conditions?

The functional role of nuoK exhibits important differences under aerobic versus anaerobic respiratory conditions:

Aerobic Respiration:
Under aerobic conditions, Complex I containing nuoK couples NADH oxidation primarily to ubiquinone reduction, generating a proton motive force with a high H+/e- ratio (approximately 4H+/2e-). The conformational changes involving nuoK are optimized for interaction with ubiquinone, which has a relatively high redox potential suitable for aerobic respiration .

Anaerobic Respiration:
During anaerobic respiration, Alternative quinones (menaquinone and demethylmenaquinone) become more prominent as electron carriers. These quinones have lower redox potentials compared to ubiquinone, which affects the energetics of electron transfer. Research with Salmonella mutants indicates that the nuoK-containing membrane domain can adapt to utilize these alternative quinones, particularly when suppressor mutations arise in Complex I subunits .

Table 3: Comparative Analysis of nuoK Function Under Different Respiratory Conditions

These functional adaptations highlight the remarkable flexibility of the respiratory complex containing nuoK, allowing bacteria to thrive under diverse environmental conditions by modifying electron transfer pathways.

What role does nuoK play in the adaptation of respiratory complexes to different electron carriers?

NuoK contributes significantly to the adaptability of respiratory complexes across different growth conditions and electron carrier availability:

• Structural Flexibility: The transmembrane helices of nuoK participate in conformational changes that accommodate different quinone species. Studies of suppressor mutations in Salmonella have shown that alterations in Complex I subunits can enhance utilization of alternative quinones when ubiquinone biosynthesis is impaired .

• Evolutionary Conservation: Comparative genomic analysis reveals that while nuoK is highly conserved among bacteria possessing Complex I, subtle sequence variations correlate with predominant quinone types used by different bacterial species. These variations primarily occur in residues facing the proposed quinone-binding cavity.

• Stress Response Adaptation: Under stress conditions that affect quinone availability (such as oxidative stress or antibiotic exposure), the nuoK-containing membrane domain undergoes subtle conformational changes that maintain respiratory function. This adaptability is particularly important for pathogenic bacteria like Salmonella enteritidis that encounter diverse host environments.

• Regulatory Interactions: Recent evidence suggests that nuoK expression and stability may be regulated in response to quinone pool composition, potentially through interaction with regulatory proteins that sense electron carrier status.

This adaptability has significant implications for understanding bacterial pathogenesis and for developing therapeutic strategies targeting respiratory chain function in pathogenic bacteria such as Salmonella enteritidis.

How can recombinant nuoK be utilized in synthetic photosynthesis systems?

Recent research has demonstrated innovative applications of modified nuoK in engineered photosynthetic systems:

A breakthrough approach involves using NuoK* (a modified version of nuoK) as an anchor protein in a biogenic photosystem called NPM* (NuoK* + PufL + MgP). This system was designed by fusing the anchor protein NuoK* with the photosynthetic reaction center protein PufL and incorporating magnesium protoporphyrin IX (MgP) molecules .

The system functions as follows:

• NuoK* serves as the anchor protein that localizes the entire photosystem to the inner membrane

• PufL functions as the core protein capable of binding MgP (an analog of bacteriochlorophyll)

• MgP facilitates photoelectron generation when exposed to light

• Methanol acts as the electron donor for the biogenic photosystem

This engineered system demonstrates several advantages:

• Uniform colocalization with the membrane, verified using EGFP fusion proteins and the membrane dye FM4-64

• Significant photoelectron generation capability, evidenced by fluorescence emission spectra and surface photovoltage measurements

• Rapid electron transfer kinetics (approximately 44.07 ps)

This application showcases how fundamental understanding of nuoK's membrane localization properties can be leveraged to develop novel bioenergetic systems with potential applications in renewable energy production.

What methodologies are most effective for incorporating nuoK into artificial membrane systems?

Creating functional artificial membrane systems containing nuoK requires specialized approaches:

Step-by-Step Methodology for nuoK Incorporation:

• Protein Preparation:

  • Express nuoK with appropriate purification tags

  • Solubilize using mild detergents (DDM or LMNG)

  • Purify to >95% homogeneity via affinity chromatography followed by size exclusion

• Liposome Preparation:

  • Prepare liposomes using E. coli polar lipid extract supplemented with 20% POPG

  • Create unilamellar vesicles through extrusion (400 nm filters followed by 200 nm)

  • Stabilize with mild detergent at sub-solubilizing concentrations

• Reconstitution Methods:

  • Direct Incorporation: Gradual detergent removal using Bio-Beads SM-2 or dialysis

  • Fusion Method: Preparation of nuoK proteoliposomes followed by fusion with target membranes

  • Cell-Free Expression: Direct synthesis of nuoK in the presence of preformed liposomes

• Functional Verification:

  • Confirm orientation using protease accessibility assays

  • Verify proton translocation capacity using pH-sensitive fluorophores

  • Assess structural integrity via freeze-fracture electron microscopy

Table 4: Comparative Analysis of nuoK Reconstitution Methods

For optimal functional incorporation, the Bio-Bead detergent removal method with a protein:lipid ratio of 1:150 provides the best balance of incorporation efficiency and functional activity. This approach has been successfully used to study proton translocation and electron transfer properties of nuoK-containing complexes in defined membrane environments.

What are the challenges and solutions for studying nuoK's role in electron transfer and proton translocation?

Investigating nuoK's precise role in electron transfer and proton translocation presents several significant challenges with corresponding advanced solutions:

Challenges and Methodological Solutions:

These advanced methodological approaches have collectively contributed to a model where nuoK participates in a conformational wave that propagates from the quinone-binding site to drive proton translocation, with conserved glutamic acid residues serving as essential components of the proton translocation pathway.

How does Salmonella enteritidis nuoK differ from homologs in other bacterial species?

Comparative analysis of nuoK across bacterial species reveals both striking conservation and notable differences:

• Core Structural Features: The transmembrane topology of nuoK is highly conserved across diverse bacterial species, typically consisting of three transmembrane helices with similar hydrophobicity profiles. This structural conservation underscores the fundamental importance of nuoK's membrane-embedded architecture.

• Species-Specific Variations: The most significant sequence divergence occurs in the loop regions connecting transmembrane segments, particularly on the cytoplasmic side. These variations likely reflect adaptations to different physiological conditions and interactions with species-specific partner proteins.

• Conservation of Functional Residues: Certain amino acids show exceptional conservation across all bacterial species, notably:

  • The glutamic acid residues (E36 and E72 in E. coli numbering) involved in proton translocation

  • Hydrophobic residues that line the proposed proton translocation channel

  • Residues at interfaces with adjacent subunits (particularly NuoM and NuoN)

• Quinone-Specificity Determinants: Subtle variations in residues proximal to the quinone-binding region correlate with the predominant quinone species utilized by different bacteria (ubiquinone vs. menaquinone).

This comparative analysis provides valuable insights into structure-function relationships and offers guidance for targeted mutational studies to elucidate nuoK's specific contributions to respiratory complex function.

What insights can structural biology provide about nuoK's role in the proton translocation mechanism?

Recent structural biology advances have provided unprecedented insights into nuoK's role in proton translocation:

While no high-resolution structure specific to Salmonella enteritidis nuoK is currently available, structures of homologous Complex I from E. coli and Thermus thermophilus offer valuable information about nuoK's architecture and functional mechanism:

• Structural Position: NuoK (ND4L) is positioned within the membrane arm of Complex I, in close association with NuoM and NuoN. This location is consistent with its role in the proton translocation pathway rather than direct involvement in electron transfer .

• Proton Translocation Channels: Structural analysis reveals that nuoK contributes to forming one of the four potential proton translocation channels in Complex I. The conserved glutamic acid residues (E36 and E72) are positioned within this channel, explaining their critical importance for proton pumping activity .

• Conformational Changes: Comparison of Complex I structures in different states suggests that nuoK undergoes significant conformational changes during the catalytic cycle. These movements appear to be transmitted from the quinone-binding site through a series of linked conformational changes.

• Quinone Interaction: While nuoK does not directly bind quinone, its proximity to the quinone-binding site suggests it plays a role in coupling quinone reduction to proton translocation. Structural data indicates that movements associated with quinone binding and reduction propagate to nuoK, triggering conformational changes that facilitate proton movement.

These structural insights, combined with functional studies of mutants, support a model where nuoK forms part of a conformationally-driven proton pump, with conserved acidic residues serving as proton-binding sites within a defined translocation pathway.

How can evolutionary analysis of nuoK inform understanding of respiratory chain adaptations?

Evolutionary analysis of nuoK provides valuable insights into the adaptation and diversification of respiratory chains:

• Phylogenetic Distribution: NuoK is present in all organisms possessing the proton-pumping NADH:quinone oxidoreductase (Complex I), spanning bacteria, archaea, and eukaryotic mitochondria. This ubiquitous distribution highlights its fundamental importance in energy conversion systems.

• Evolutionary Rate: Comparative genomic analysis reveals that nuoK evolves at a slower rate than many other Complex I subunits, reflecting strong selective pressure to maintain its core function in proton translocation.

• Co-evolutionary Patterns: Statistical coupling analysis of nuoK sequences across diverse species reveals strong co-evolutionary relationships with other membrane domain subunits, particularly NuoM and NuoN. These patterns reflect the functional interdependence of these subunits in forming a coordinated proton translocation machinery.

• Adaptation to Respiratory Diversity: Subtle sequence variations in nuoK correlate with adaptations to different:

  • Electron carriers (ubiquinone vs. menaquinone)

  • Environmental niches (aerobic vs. microaerobic vs. anaerobic)

  • Metabolic strategies (heterotrophy vs. lithoautotrophy)

• Horizontal Gene Transfer: Analysis of nuoK sequences suggests that while the core Complex I genes typically evolve as a unit, instances of horizontal gene transfer have occurred, particularly in extremophile bacteria adapting to new ecological niches.

This evolutionary perspective provides a framework for understanding how nuoK has retained its fundamental role in bioenergetics while allowing sufficient flexibility for adaptation to diverse environmental conditions and metabolic strategies.