Recombinant Salmonella enteritidis PT4 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SEN3198; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: set:SEN3198

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of AaeA in Salmonella enteritidis PT4?

AaeA functions as the membrane fusion protein component of the AaeAB efflux pump system in Salmonella enteritidis PT4. This system is specifically involved in the efflux of aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA). The AaeA subunit works in conjunction with AaeB to form a functional efflux apparatus that spans the bacterial cell envelope.

The physiological role of this system appears to be as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism, particularly accumulation of aromatic carboxylic acids that could be detrimental to cellular function. Studies in Escherichia coli have demonstrated that expression of both aaeA and aaeB is necessary and sufficient for protection against pHBA toxicity .

What are the optimal conditions for expressing recombinant Salmonella enteritidis PT4 AaeA protein?

The recombinant production of Salmonella enteritidis PT4 AaeA protein can be successfully achieved using Escherichia coli expression systems. Based on current protocols, the following conditions are recommended:

ParameterRecommended Condition
Expression SystemE. coli
Vector TypepET series with N-terminal His-tag
InductionIPTG (0.5-1.0 mM)
Temperature25-30°C post-induction
Duration4-6 hours or overnight at lower temperature
Cell LysisSonication or pressure-based disruption
Protein PurificationNi-NTA affinity chromatography

It is important to note that membrane-associated proteins like AaeA can present challenges during expression and purification. Including mild detergents in the purification buffers may enhance protein solubility and stability .

What are the recommended storage conditions for purified recombinant AaeA protein?

To maintain the stability and activity of purified recombinant Salmonella enteritidis PT4 AaeA protein, the following storage conditions are recommended:

  • Primary storage should be at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles.

  • The optimal storage buffer consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0.

  • For longer-term storage, adding 5-50% glycerol (final concentration) is recommended, with 50% being the default concentration used in most protocols.

  • For working stocks, maintain aliquots at 4°C for up to one week.

  • After reconstitution, the protein should be diluted to 0.1-1.0 mg/mL in deionized sterile water.

These storage recommendations help preserve protein integrity and functional activity for experimental use .

How does the aaeA gene regulation differ between Salmonella enteritidis and Escherichia coli?

The regulation of aaeA exhibits both similarities and differences between Salmonella enteritidis and Escherichia coli:

In Escherichia coli, the aaeA gene (formerly yhcQ) is part of the aaeXAB operon, which is regulated by the upstream, divergently transcribed aaeR gene encoding a LysR family regulatory protein. This system responds to aromatic carboxylic acids, with p-hydroxybenzoic acid (pHBA) being a primary inducer. Treatment of E. coli with pHBA results in significant upregulation of aaeA .

In Salmonella enteritidis PT4, genomic analysis reveals a similar operon structure, but with potential differences in regulatory mechanisms. While the core components of the efflux system are conserved between the two species, comparative genomic studies suggest variations in regulatory networks. The average nucleotide identity between shared orthologs of Salmonella enteritidis PT4 and Salmonella Typhimurium LT2 is approximately 98.98%, indicating potential functional differences in gene regulation even among Salmonella serovars .

Furthermore, the expression of aaeA in Salmonella enteritidis may be influenced by small regulatory RNAs such as SaaS, which has been shown to modulate the expression of various virulence-associated genes in response to environmental stimuli .

What role might AaeA play in Salmonella enteritidis antimicrobial resistance?

The AaeA protein, as a component of the AaeAB efflux system, potentially contributes to Salmonella enteritidis antimicrobial resistance through several mechanisms:

  • Direct efflux of antimicrobial compounds: While the AaeAB system primarily extrudes aromatic carboxylic acids, it may have broader substrate specificity that includes certain antimicrobial agents or their metabolites. Studies in E. coli have shown that only a few aromatic carboxylic acids from hundreds of tested compounds were defined as substrates, suggesting specificity but also the possibility of unidentified substrates .

  • Cross-resistance mechanisms: The upregulation of one efflux system can sometimes confer resistance advantages through general stress response pathways or through compensatory mechanisms affecting other resistance determinants.

  • Biofilm formation: Efflux pumps, including those involved in metabolite export, have been implicated in biofilm formation, which can enhance antimicrobial resistance through physical barriers and altered metabolic states.

  • Metabolic adaptation: The "metabolic relief valve" function proposed for the AaeAB system suggests a role in maintaining cellular homeostasis under stress conditions, potentially contributing to survival during antimicrobial exposure.

Research methodologies to investigate these aspects would include gene knockout studies, antimicrobial susceptibility testing of mutant strains, transcriptomic analysis under various stress conditions, and in vitro selection of resistant mutants followed by genomic characterization.

How conserved is the AaeA protein across different Salmonella serovars?

The AaeA protein shows significant conservation across Salmonella serovars, reflecting its important functional role. Comparative genomic analysis indicates:

  • Sequence conservation: The core domains and functional regions of AaeA are highly conserved across Salmonella enterica subspecies, with particular preservation of transmembrane domains and substrate interaction sites.

  • Synteny: The genomic organization of the aaeA gene and its associated operon structure is maintained across various Salmonella serovars, including Enteritidis PT4 and Typhimurium LT2. This conservation of synteny suggests functional importance of the efflux system .

  • Evolutionary stability: Unlike some virulence factors or antibiotic resistance determinants that may show evidence of horizontal gene transfer or rapid evolution, the AaeA protein appears to be part of the ancestral core genome of Salmonella.

  • Host-adaptation considerations: Interestingly, in host-restricted Salmonella serovars like S. Gallinarum (which has evolved from S. Enteritidis), there is a higher number of pseudogenes compared to broad-host range serovars like S. Enteritidis PT4. While specific data on aaeA pseudogenization in these strains is limited in the provided search results, this pattern suggests potential differential selection pressures on metabolic systems during host adaptation .

What methodological approaches are most effective for studying AaeA interactions with other efflux pump components?

To effectively study AaeA interactions with other efflux pump components, particularly AaeB, researchers should consider employing a multi-faceted approach:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation (Co-IP) using antibodies against tagged versions of AaeA

    • Bacterial two-hybrid systems to detect direct interactions

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

  • Structural biology approaches:

    • X-ray crystallography of the AaeA protein alone and in complex with AaeB

    • Cryo-electron microscopy to visualize the entire efflux pump complex

    • Molecular dynamics simulations to predict interaction domains

    • NMR spectroscopy for analyzing protein dynamics during substrate binding and transport

  • Functional genomics:

    • Site-directed mutagenesis of potential interaction domains

    • Suppressor mutation analysis to identify compensatory changes

    • Domain swapping experiments between homologous proteins from different species

    • Construction of chimeric proteins to identify functional domains

  • In vivo imaging:

    • Fluorescent protein fusions to visualize localization and co-localization

    • Single-molecule tracking to observe dynamics in living cells

    • Super-resolution microscopy to determine spatial organization of efflux complexes

These methodological approaches, used in combination, would provide comprehensive insights into how AaeA interacts with AaeB and potentially other components to form a functional efflux system in Salmonella enteritidis PT4.

What methodologies are most appropriate for investigating the role of AaeA in Salmonella virulence?

To comprehensively investigate the role of AaeA in Salmonella virulence, researchers should employ a combination of molecular, cellular, and in vivo approaches:

  • Genetic manipulation:

    • Construction of clean deletion mutants (ΔaaeA)

    • Complementation studies with wild-type and mutated versions of aaeA

    • Conditional expression systems to control AaeA levels during specific infection stages

    • CRISPR-Cas9 genome editing for precise modifications

  • In vitro infection models:

    • Epithelial cell invasion assays using Caco-2 or similar intestinal epithelial cell lines

    • Macrophage survival assays using RAW 264.7 cells to assess intracellular persistence

    • Co-culture systems with multiple cell types to better simulate host tissue environments

    • Simulated intestinal environment (SIE) systems to study environmental regulation

  • In vivo infection models:

    • BALB/c mouse model of systemic salmonellosis

    • Streptomycin-pretreated mouse model for studying gastrointestinal colonization

    • Competitive index assays comparing wild-type and ΔaaeA strains in mixed infections

    • Tissue-specific bacterial burden assessment in liver, spleen, and intestinal tissues

  • Transcriptomic and proteomic analyses:

    • RNA-Seq to compare gene expression profiles between wild-type and ΔaaeA strains

    • Quantitative proteomics to identify changes in protein expression

    • ChIP-Seq to identify regulatory networks affecting aaeA expression

    • Metabolomics to detect changes in bacterial or host metabolites

Similar methodologies have proven effective in studying other Salmonella virulence factors. For example, researchers investigating the SseB protein as a vaccine candidate used recombinant protein expression in E. coli, western blotting for immunoreactivity assessment, and mouse challenge models to evaluate protection against virulent Salmonella Enteritidis . Additionally, studies on the effector AvrA employed immunoblotting techniques and pathogenicity assessments to determine its role in Salmonella virulence .

What techniques are most effective for measuring AaeA-mediated efflux activity?

To accurately measure AaeA-mediated efflux activity, researchers should consider the following techniques, each addressing different aspects of efflux pump function:

  • Fluorescent substrate accumulation/efflux assays:

    • Use fluorescent substrates (if available) or fluorescently labeled p-hydroxybenzoic acid derivatives

    • Monitor intracellular accumulation in wild-type versus ΔaaeA strains

    • Measure real-time efflux kinetics after energizing cells with glucose

  • Radioisotope-based transport assays:

    • Use radiolabeled substrates (e.g., 14C-labeled p-hydroxybenzoic acid)

    • Quantify uptake and efflux rates in membrane vesicles or whole cells

    • Compare transport kinetics between wild-type and mutant strains

  • Growth inhibition assays:

    • Determine minimum inhibitory concentrations (MICs) of known substrates

    • Generate dose-response curves for various potential substrates

    • Compare growth kinetics in the presence of toxic substrates

  • Direct measurement of substrate transport:

    • High-performance liquid chromatography (HPLC) to quantify substrate levels

    • Mass spectrometry to identify and quantify transported compounds

    • Nuclear magnetic resonance (NMR) spectroscopy for structural characterization of substrates

  • Membrane potential monitoring:

    • Use membrane potential-sensitive dyes to assess the energetics of transport

    • Determine the dependence of efflux on proton motive force or ATP

  • Reconstituted systems:

    • Reconstitute purified AaeA and AaeB into proteoliposomes

    • Measure transport activities in the controlled environment of artificial membranes

    • Assess the effects of membrane composition on transport efficiency

Research in E. coli has demonstrated that mutant strains lacking aaeA show hypersensitivity to p-hydroxybenzoic acid, confirming its role in efflux . Similar methodologies could be applied to study the Salmonella enteritidis AaeA protein, with appropriate controls and substrate selections based on the specific research questions being addressed.

Citations Creative Biomart. Recombinant Full Length Salmonella Enteritidis Pt4 P-Hydroxybenzoic Acid Efflux Pump Subunit Aaea(Aaea) Protein, His-Tagged. Van Dyk, T. K., Templeton, L. J., Cantera, K. A., Sharpe, P. L., & Sariaslani, F. S. (2004). Characterization of the Escherichia coli AaeAB efflux pump: a metabolic relief valve?. Journal of bacteriology, 186(21), 7196-7204. Thomson, N. R., Clayton, D. J., Windhorst, D., Vernikos, G., Davidson, S., Churcher, C., ... & Parkhill, J. (2008). Comparative genome analysis of Salmonella Enteritidis PT4 and Salmonella Gallinarum 287/91 provides insights into evolutionary and host adaptation pathways. Genome research, 18(10), 1624-1637. Bao, X., Okunade, O., Zuo, X., & Zhang, W. (2023). A Small RNA, SaaS, Promotes Salmonella Pathogenicity by Regulating Virulence-Related Genes. Microbiology Spectrum, 11(1), e02938-22. Peng, Z., Zou, H., Li, X., Tang, X., Hong, S., Liu, H., ... & Jiao, X. (2022). Salmonella Enteritidis Subunit Vaccine Candidate Based on SseB Adjuvanted with Simvastatin. Vaccines, 10(4), 562. Zhang, S., Chen, X., Zhou, Y., Xu, W., Chen, P., Lin, Y., ... & Feng, Y. (2020). Salmonella Enteritidis Effector AvrA Suppresses Autophagy by Reducing Beclin-1 Protein Levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.