Recombinant Salmonella enteritidis PT4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

ArnE is a subunit of the ArnEF translocon complex responsible for translocating 4-amino-4-deoxy-L-arabinose (L-Ara4N)-modified phosphoundecaprenol across the inner membrane of Gram-negative bacteria . This modification enables Salmonella to alter its outer membrane charge, reducing susceptibility to host-derived antimicrobial peptides . The recombinant form is expressed in E. coli with an N-terminal His tag for purification .

Functional Mechanism

ArnE operates in conjunction with ArnF to flip L-Ara4N-phosphoundecaprenol from the cytoplasmic to the periplasmic leaflet of the inner membrane . This step is essential for the subsequent transfer of L-Ara4N to lipid A, a process mediated by the ArnT transferase . The modification neutralizes the negative charge of lipid A, impeding the binding of cationic antimicrobial agents .

Research Applications

Recombinant ArnE is utilized in:

  • Antimicrobial Resistance Studies: Elucidating mechanisms of polymyxin resistance in Salmonella .

  • Structural Biology: Investigating membrane protein topology and lipid interaction dynamics .

  • Drug Development: Screening inhibitors targeting lipid A modification pathways .

Comparative Analysis Across Salmonella Species

ArnE homologs are conserved in other Salmonella serovars, highlighting its evolutionary importance:

SpeciesUniProt IDLength (aa)Function
Salmonella enteritidis PT4B5R275111L-Ara4N-phosphoundecaprenol flippase subunit
Salmonella typhiP81891111Lipid A modification
Salmonella paratyphi BA9N5A9111Antimicrobial resistance

Recent Research Findings

  • Genomic Context: The arnE gene is located within pathogenicity islands (SPIs) in Salmonella enteritidis PT4, alongside other virulence factors like type III secretion systems (T3SS) .

  • Phenotypic Impact: Strains lacking functional ArnE show increased susceptibility to polymyxin B, confirming its role in resistance .

  • Structural Insights: The EamA domain of ArnE facilitates substrate recognition and membrane flipping .

Future Directions

Ongoing research aims to:

  • Characterize ArnE’s interaction with ArnF using cryo-EM .

  • Develop high-throughput assays to identify ArnE inhibitors .

  • Explore the protein’s role in biofilm formation and host adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format when placing your order, and we will prepare it accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
arnE; SEN2284; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
arnE
Target Protein Sequence
MIGVILVLASLLSVGGQLCQKQATRPLTVGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWFGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: set:SEN2284

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnE protein and what is its role in Salmonella enteritidis PT4?

ArnE, formerly known as PmrL, functions as a subunit of an undecaprenyl phosphate-α-L-Ara4N flippase in Salmonella enteritidis. It works in conjunction with ArnF (formerly PmrM) to transport the lipid-linked donor molecule undecaprenyl phosphate-α-L-Ara4N from the cytoplasmic side to the periplasmic side of the inner membrane . This transport is crucial for the subsequent modification of lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N), which confers resistance to polymyxin and other cationic antimicrobial peptides in gram-negative bacteria such as Salmonella .

The ArnE protein is part of a larger biosynthetic pathway that starts with UDP-glucose and proceeds through several enzymatic steps before the L-Ara4N moiety is ultimately transferred to lipid A by ArnT on the periplasmic face of the inner membrane . Without functional ArnE, bacteria become susceptible to polymyxin antibiotics due to their inability to modify lipid A with L-Ara4N, even when the precursor undecaprenyl phosphate-α-L-Ara4N is present in the cell .

How can researchers effectively design experiments to study ArnE function?

When designing experiments to investigate ArnE function, researchers should consider the following methodological approach:

  • Hypothesis formulation: Clearly define your variables and how they are related. For example, when studying ArnE's role in antimicrobial resistance, the independent variable could be ArnE expression levels, while the dependent variable would be polymyxin resistance .

  • Genetic manipulation strategies:

    • Generate clean deletion mutants of arnE using lambda Red recombination or CRISPR-Cas9

    • Create point mutations in conserved residues to identify functionally important domains

    • Develop complementation strains to verify phenotype restoration

  • Phenotypic assays:

    • Minimum inhibitory concentration (MIC) determinations for polymyxin and other cationic antimicrobial peptides

    • Growth curves under various antimicrobial stresses

    • Lipid A analysis by mass spectrometry to quantify L-Ara4N modifications

  • Control for extraneous variables: Account for potential confounding factors such as growth conditions, media composition, and bacterial growth phase, which can affect expression of the pmrA regulon that controls arnE expression .

  • Statistical analysis: Apply appropriate statistical tests (e.g., t-tests for comparing MICs, ANOVA for multiple condition comparisons) with adequate sample sizes to ensure meaningful results .

What methods are available for detecting and quantifying L-Ara4N modifications of lipid A?

Researchers can employ several complementary techniques to detect and quantify L-Ara4N modifications:

TechniqueApplicationAdvantagesLimitations
Mass SpectrometryDirect analysis of lipid A modificationsHigh resolution, can identify multiple modifications simultaneouslyRequires specialized equipment, complex data analysis
TLC AnalysisSeparation of lipid A speciesRelatively simple, low costLimited resolution, semi-quantitative
Polymyxin Resistance AssaysIndirect measure of L-Ara4N modificationFunctional relevance, straightforwardIndirect measure, may be affected by other resistance mechanisms
RadiolabelingTracking incorporation of labeled precursorsHighly sensitiveSafety concerns, specialized facilities required
N-hydroxysulfosuccinimido-biotin LabelingSurface accessibility of undecaprenyl phosphate-α-L-Ara4NCan distinguish inner vs. outer leaflet localizationIndirect measure, requires careful controls

The choice of method depends on the specific research question. For instance, when determining whether ArnE influences the translocation of undecaprenyl phosphate-α-L-Ara4N, researchers have successfully used N-hydroxysulfosuccinimido-biotin labeling to demonstrate reduced presence of the molecule on the periplasmic face of the inner membrane in arnE mutants .

How does the ArnE-ArnF complex function as a flippase in the bacterial inner membrane?

The ArnE-ArnF complex likely functions as a heterodimeric flippase that facilitates the translocation of undecaprenyl phosphate-α-L-Ara4N across the bacterial inner membrane. Research suggests the following mechanism:

  • Complex formation: ArnE and ArnF (formerly PmrL and PmrM) interact to form a functional transmembrane complex that creates a pathway for the lipid-linked substrate .

  • Substrate recognition: The complex specifically recognizes undecaprenyl phosphate-α-L-Ara4N, distinguishing it from other lipid-linked substrates in the membrane.

  • Translocation mechanism: The complex likely facilitates the energetically unfavorable "flip-flop" of the polar head group (L-Ara4N) across the hydrophobic interior of the membrane while keeping the undecaprenyl phosphate portion anchored in the membrane.

  • Directionality: The flippase operates unidirectionally, transporting the substrate from the cytoplasmic leaflet to the periplasmic leaflet where ArnT can access it .

Evidence for this mechanism comes from studies showing that mutations in either arnE or arnF result in polymyxin sensitivity despite normal levels of undecaprenyl phosphate-α-L-Ara4N in the cell. Critically, labeling experiments with membrane-impermeable amine reagents (N-hydroxysulfosuccinimido-biotin) revealed 4-5-fold reduced labeling of undecaprenyl phosphate-α-L-Ara4N on the periplasmic surface in arnE/arnF mutants compared to wild-type or arnT mutant strains .

What are the best approaches for resolving contradictory findings in ArnE research literature?

When faced with contradictory findings regarding ArnE function or mechanisms, researchers should employ a systematic approach:

This approach has been successfully applied in other fields to resolve contradictions. For example, natural language processing tools have been developed to help identify contradictory claims in biomedical literature, allowing researchers to focus their experimental efforts on directly addressing key discrepancies .

How can structural biology approaches be applied to understand ArnE function?

Membrane proteins like ArnE present significant challenges for structural studies, but several approaches can be employed:

  • Protein expression and purification optimization:

    • Test multiple fusion tags (His, MBP, SUMO) to improve solubility and stability

    • Use specialized detergents (DDM, LMNG, GDN) for extraction while maintaining function

    • Consider nanodiscs or SMALPs to maintain a native-like lipid environment

  • Structural determination methods:

    • X-ray crystallography: Requires growing well-ordered 3D crystals, which is challenging for membrane proteins

    • Cryo-electron microscopy: Increasingly useful for membrane proteins, especially in complex with partner proteins

    • NMR spectroscopy: Useful for dynamics studies but typically limited to smaller proteins or domains

    • AlphaFold2 and other AI-based prediction: Can provide initial models to guide experimental design

  • Functional validation of structural insights:

    • Site-directed mutagenesis of predicted functional residues

    • Cross-linking studies to map interaction interfaces between ArnE and ArnF

    • Accessibility studies using cysteine-scanning mutagenesis combined with thiol-reactive probes

  • Molecular dynamics simulations:

    • Model ArnE-ArnF interaction with the membrane

    • Simulate substrate binding and translocation events

    • Predict conformational changes during the transport cycle

A combination of these approaches would provide complementary insights into ArnE structure-function relationships and potentially reveal the molecular mechanism of L-Ara4N flipping across the membrane.

What experimental controls are essential when studying the impact of ArnE mutations on polymyxin resistance?

Rigorous experimental controls are critical when evaluating how ArnE mutations affect polymyxin resistance:

  • Genetic controls:

    • Wild-type parent strain (positive control)

    • Clean deletion mutant (ΔarnE)

    • Complemented strain (ΔarnE + arnE on plasmid)

    • Point mutants of conserved residues

    • Mutations in other arn pathway genes as comparators (particularly arnF and arnT)

  • Expression controls:

    • qRT-PCR to verify equivalent expression levels across complemented strains

    • Western blotting with epitope-tagged versions to confirm protein production

    • Inducible promoters to test dose-dependency of complementation

  • Phenotypic controls:

    • Growth curves in non-selective media to ensure mutations don't cause general growth defects

    • Testing resistance to non-relevant antibiotics to confirm specificity of effects

    • Testing at multiple polymyxin concentrations to generate dose-response curves

  • Biochemical controls:

    • Mass spectrometry of lipid A to confirm specific loss of L-Ara4N modification

    • Analysis of undecaprenyl phosphate-α-L-Ara4N levels to ensure substrate availability

    • Membrane fractionation to verify proper protein localization

  • Environmental controls:

    • Testing under PmrA/PmrB-inducing and non-inducing conditions

    • Controlling temperature, pH, and divalent cation concentrations, which affect the PmrA regulon

    • Testing in both laboratory media and conditions mimicking host environments

A well-designed experiment investigating ArnE function should include these controls to ensure that observed phenotypes can be specifically attributed to the flippase function of ArnE rather than indirect effects .

How can researchers effectively differentiate between the roles of ArnE and ArnF in the flippase complex?

Distinguishing the specific contributions of ArnE and ArnF to flippase function requires sophisticated experimental approaches:

  • Individual and double mutant analysis:

    • Compare phenotypes of ΔarnE, ΔarnF, and ΔarnEF mutants

    • Analyze the degree of polymyxin sensitivity in each mutant

    • Measure lipid A modifications in each genetic background

  • Complementation studies:

    • Test cross-complementation (can overexpression of one protein compensate for loss of the other?)

    • Create chimeric proteins with domains swapped between ArnE and ArnF

    • Use site-directed mutagenesis to identify functionally important residues specific to each protein

  • Protein-protein interaction studies:

    • Bacterial two-hybrid or split-ubiquitin assays to confirm direct interaction

    • Co-immunoprecipitation with differentially tagged versions

    • FRET or BiFC to visualize interactions in vivo

    • Crosslinking studies followed by mass spectrometry to map interaction interfaces

  • Biochemical approaches:

    • Reconstitute flippase activity in proteoliposomes with purified components

    • Test flippase activity with various ratios of ArnE:ArnF to determine stoichiometry

    • Develop in vitro assays that can measure flipping of fluorescently labeled lipid analogs

  • Structural approaches:

    • Attempt co-crystallization of ArnE and ArnF

    • Use cryo-EM to determine the structure of the complex

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational changes

These approaches can build on the evidence from existing studies showing that both proteins are required for full functionality of the flippase complex, helping to determine whether they contribute equally or have distinct roles in substrate recognition, binding, or translocation .

What statistical approaches should be used when analyzing polymyxin susceptibility data in ArnE studies?

  • For MIC (Minimum Inhibitory Concentration) data:

    • Use non-parametric tests (Mann-Whitney U or Kruskal-Wallis) for comparing MIC values between strains

    • Report both median and range values rather than means when distributions aren't normal

    • Consider using fold-change in MIC rather than absolute values for more meaningful comparisons

    • For time-course experiments, apply repeated measures ANOVA to account for temporal correlation

  • For survival assays:

    • Use log-rank tests for comparing survival curves

    • Apply Cox proportional hazards models to control for covariates

    • Present data using Kaplan-Meier plots with confidence intervals

  • For dose-response experiments:

    • Fit data to Hill equation or other appropriate models to determine EC50/IC50 values

    • Use extra sum-of-squares F-test to compare curve parameters between strains

    • Report both curve parameters and goodness-of-fit statistics

  • Sample size determination:

    • Conduct power analysis prior to experimentation

    • For typical polymyxin resistance assays in Salmonella, a minimum of 3-5 biological replicates with 2-3 technical replicates each is generally recommended

    • Increase sample size when comparing subtle phenotypic differences

  • Multiple testing correction:

    • Apply Bonferroni or false discovery rate corrections when performing multiple comparisons

    • Consider hierarchical testing strategies to maintain statistical power

For example, when comparing polymyxin susceptibility between wild-type, ΔarnE, ΔarnF, and complemented strains, researchers should first use a Kruskal-Wallis test to determine if any differences exist, followed by pairwise Mann-Whitney U tests with appropriate corrections for multiple comparisons .

How can researchers accurately quantify the translocation of undecaprenyl phosphate-α-L-Ara4N across the membrane?

Accurately quantifying the translocation of undecaprenyl phosphate-α-L-Ara4N across the bacterial inner membrane presents technical challenges that can be addressed through several complementary approaches:

  • Cell surface labeling techniques:

    • Membrane-impermeable reagents like N-hydroxysulfosuccinimido-biotin can specifically label molecules exposed on the periplasmic face of the inner membrane

    • Quantitative comparison of labeling between wild-type and arnE/arnF mutants provides evidence of translocation defects

    • Include appropriate controls: an arnT mutant should show normal labeling despite lacking lipid A modification

  • Fluorescence-based assays:

    • Develop fluorescently-labeled analogs of undecaprenyl phosphate-α-L-Ara4N

    • Use fluorescence quenching or FRET-based assays in reconstituted proteoliposomes

    • Monitor flipping rates in real-time under various conditions

  • Fractionation approaches:

    • Separate inner membrane leaflets using established techniques like freeze-fracture or chemical treatments

    • Extract and analyze lipids from each fraction using mass spectrometry

    • Compare relative abundance of undecaprenyl phosphate-α-L-Ara4N between fractions

  • Enzymatic accessibility assays:

    • Use periplasmic enzymes that specifically modify undecaprenyl phosphate-α-L-Ara4N

    • Compare modification rates between wild-type and mutant strains

    • Control for enzyme activity and substrate levels

  • Quantitative analysis considerations:

    • Normalize measurements to total membrane lipid content or appropriate housekeeping molecules

    • Use internal standards for mass spectrometry-based quantification

    • Apply appropriate statistical tests to determine significance of observed differences

    • Consider kinetic measurements to determine flipping rates rather than just steady-state levels

The combined use of these methods allows researchers to build a comprehensive picture of ArnE-ArnF flippase activity and its contribution to antimicrobial resistance in Salmonella enteritidis PT4 .

How might ArnE function differ between various Salmonella serovars and other gram-negative bacteria?

Comparative analysis of ArnE across bacterial species may reveal important functional variations:

  • Sequence conservation analysis:

    • ArnE homologs are found in many gram-negative bacteria, including pathogenic species like Salmonella enteritidis PT4, PT8/7, and other serovars

    • Comparative genomics reveals varying degrees of conservation in different bacterial lineages

    • Identification of highly conserved residues may indicate functionally critical regions

  • Functional complementation studies:

    • Cross-species complementation experiments can determine functional equivalence

    • For example, testing whether ArnE from Salmonella enteritidis PT4 can restore polymyxin resistance in ΔarnE mutants of other Salmonella serovars or even other genera like Escherichia or Pseudomonas

    • Chimeric proteins with domains from different species can help map functional differences

  • Regulatory differences:

    • The regulation of arnE expression varies between species and serovars

    • In Salmonella, expression is typically controlled by the PmrA/PmrB two-component system

    • Different activation thresholds or environmental triggers may exist in various species

    • Some species may have additional regulatory mechanisms affecting arnE expression

  • Correlation with natural polymyxin resistance profiles:

    • Different Salmonella serovars show varying levels of intrinsic polymyxin resistance

    • For example, S. Enteritidis PT8/7 is not known for particularly high virulence or pathogenicity compared to other phage types

    • Comparative studies can reveal whether these differences correlate with variations in ArnE structure or function

  • Host adaptation considerations:

    • Host-adapted Salmonella serovars may have evolved specialized versions of ArnE to cope with specific host defense mechanisms

    • Comparing ArnE function in host-restricted versus broad-host-range serovars may provide insights into bacterial adaptation strategies

This comparative approach could reveal evolutionary adaptations in ArnE that contribute to varying levels of antimicrobial resistance and virulence across bacterial species and provide insights into potential species-specific inhibitor development .

What are the implications of ArnE research for developing novel antimicrobial strategies?

Research on ArnE provides several promising avenues for novel antimicrobial development:

  • Direct ArnE inhibitors:

    • Small molecules targeting the ArnE-ArnF flippase complex could potentiate the activity of polymyxins and other cationic antimicrobial peptides

    • High-throughput screening approaches using bacterial survival or flippase activity assays could identify lead compounds

    • Structure-based drug design could be employed once structural information becomes available

  • Combination therapy approaches:

    • Sub-inhibitory concentrations of polymyxins combined with ArnE inhibitors could show synergistic effects

    • This approach might reduce the required dose of polymyxins, minimizing toxicity concerns

    • Experimental design would need to carefully evaluate:

      • Optimal drug ratios

      • Potential for resistance development

      • In vivo efficacy and toxicity profiles

  • Pathogen-specific targeting:

    • Exploiting structural or functional differences in ArnE between bacterial species could lead to narrow-spectrum agents

    • This approach may help preserve beneficial microbiota compared to broad-spectrum antibiotics

    • Species-specific inhibitors could be particularly valuable for treating Salmonella infections, which caused severe outcomes even in healthy individuals as seen in outbreak studies

  • Resistance modulation strategies:

    • Rather than killing bacteria directly, ArnE inhibitors could render pathogens susceptible to host defense mechanisms

    • This approach might reduce selective pressure for resistance development

    • Could be particularly effective against foodborne pathogens like Salmonella enteritidis, which has shown high attack rates (up to 100% in some outbreaks)

  • Biomarker development:

    • Understanding ArnE function and regulation could lead to diagnostic tools that predict antimicrobial resistance

    • Mass spectrometry detection of L-Ara4N-modified lipid A could serve as a biomarker for potential polymyxin resistance

    • Such diagnostics would enable more targeted antimicrobial therapy

These approaches represent promising directions for leveraging ArnE research to address the growing challenge of antimicrobial resistance in Salmonella and other gram-negative pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.