Recombinant Salmonella enteritidis PT4 Probable intracellular septation protein A (yciB)

What is yciB and what is its predicted function in Salmonella enteritidis PT4?

The yciB gene (also known as SEN1299) encodes a probable intracellular septation protein A in Salmonella enteritidis PT4. It is classified as an inner membrane-spanning protein with a full length of 179 amino acids. The protein contains multiple transmembrane domains as evidenced by its highly hydrophobic amino acid sequence, suggesting its integration within the bacterial cell membrane . While its precise function remains under investigation, genomic analysis suggests it plays a role in cell division processes, particularly septation during bacterial replication. The protein is part of the broader virulence mechanisms in Salmonella enteritidis, which includes various factors involved in cell invasion, intestinal colonization, and intracellular survival within host cells . The protein's membrane localization suggests it may participate in maintaining cell envelope integrity, which is crucial for bacterial survival during host infection and environmental stress responses.

How is yciB structurally characterized and what domains are functionally significant?

Based on sequence analysis, yciB (Uniprot ID: B5R3N5) is a membrane protein with multiple hydrophobic regions that likely form transmembrane helices. The amino acid sequence (MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAVFGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLNLAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS) reveals a protein rich in hydrophobic amino acids consistent with transmembrane domains .

The N-terminal region contains a signal sequence characteristic of membrane proteins, while internal hydrophobic stretches form the transmembrane domains. The functional domains likely include regions involved in protein-protein interactions necessary for septation processes during cell division. While specific functional domains have not been fully characterized in the available literature, comparative genomic analysis with related Salmonella strains indicates conservation of this protein, suggesting an important role in bacterial cell physiology. Structural prediction methods can be employed to further elucidate domain organization and potential interaction sites within the protein structure.

How does yciB contribute to Salmonella enteritidis virulence mechanisms?

While yciB is not explicitly listed among the 165 virulence factors identified in the Salmonella enteritidis PT4 578 genome, its role as a membrane protein may indirectly contribute to bacterial pathogenicity . Salmonella virulence is a multifactorial process involving numerous genes that enable bacterial adaptation, invasion, and survival within host environments. As an inner membrane protein potentially involved in septation, yciB likely contributes to maintaining cellular integrity during infection processes.

The pathogenicity of Salmonella enteritidis relies on multiple mechanisms including type III secretion systems (T3SS) encoded by Salmonella pathogenicity islands (SPIs), particularly SPI-1 and SPI-2, which facilitate host cell invasion and intracellular survival respectively . While yciB is not directly associated with these secretion systems, proper membrane function is essential for their assembly and operation. Additionally, membrane proteins often play roles in stress response and adaptation to environmental changes encountered during infection, potentially making yciB an indirect contributor to virulence capabilities.

What are the optimal conditions for handling recombinant yciB protein in laboratory settings?

The recombinant yciB protein from Salmonella enteritidis PT4 requires specific handling conditions to maintain its structural integrity and functional properties. When received as a lyophilized powder, the protein should be briefly centrifuged to bring contents to the bottom of the vial before opening . Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol to a final concentration of 5-50% (with 50% being recommended) helps preserve protein stability .

The reconstituted protein should be stored at -20°C/-80°C, with aliquoting being necessary to avoid repeated freeze-thaw cycles that can denature the protein . For short-term work, aliquots can be stored at 4°C for up to one week. When designing experiments, consider that yciB is a membrane protein, which may require specific buffer conditions containing mild detergents to maintain its native conformation. Protein activity assays should be performed promptly after thawing to ensure optimal functionality in experimental applications.

How can researchers effectively integrate yciB in membrane-based experimental systems?

As an inner membrane-spanning protein, working with recombinant yciB requires specialized approaches for integration into membrane-based experimental systems. Researchers should consider the following methodological strategies:

• Liposome reconstitution: Incorporating yciB into artificial lipid bilayers can create a native-like environment. This typically involves mixing the protein with phospholipids in detergent, followed by detergent removal through dialysis or adsorption.

• Nanodiscs formation: For structural and functional studies, yciB can be incorporated into nanodiscs – disc-shaped phospholipid bilayers encircled by membrane scaffold proteins – providing a stable, soluble platform for membrane protein analysis.

• Detergent selection: When working with yciB, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) are preferable for maintaining protein structure while solubilizing membrane components.

• Buffer optimization: Membrane proteins require buffers that mimic physiological conditions; typically, phosphate or Tris buffers (pH 7.0-8.0) containing small amounts of detergent and possibly specific lipids to maintain the protein's native environment .

The His-tag present on the recombinant yciB can be leveraged for oriented reconstitution into lipid bilayers using Ni-NTA containing lipids or for purification procedures before membrane incorporation.

What experimental approaches can effectively assess yciB interactions with other bacterial proteins?

To assess yciB interactions with other bacterial proteins, researchers should employ complementary approaches that account for its membrane-bound nature:

• Pull-down assays: Utilizing the His-tag on recombinant yciB, researchers can perform pull-down experiments with bacterial lysates to identify potential binding partners. This approach requires careful optimization of detergent conditions to maintain membrane protein solubility while preserving protein-protein interactions.

• Bacterial two-hybrid systems: Modified bacterial two-hybrid systems tailored for membrane proteins can assess potential interactions in a cellular context. The BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system is particularly suitable for membrane protein interaction studies.

• Co-immunoprecipitation with crosslinking: Chemical crosslinking followed by co-immunoprecipitation can capture transient or weak interactions between yciB and partner proteins within the membrane environment.

• Fluorescence resonance energy transfer (FRET): For in vivo interaction studies, fluorescently tagged versions of yciB and potential partners can be expressed in bacterial cells to detect proximity-based energy transfer.

• Surface plasmon resonance (SPR): This technique can quantitatively measure binding kinetics between purified yciB reconstituted in lipid bilayers and potential interacting proteins.

When interpreting results, researchers should consider that yciB may participate in multiprotein complexes involved in septation, requiring the presence of multiple factors for stable interactions to occur.

How does yciB function relate to Salmonella pathogenicity islands and virulence mechanisms?

While yciB is not directly encoded within the twelve Salmonella pathogenicity islands (SPIs) identified in Salmonella enteritidis PT4, its function as a membrane protein may indirectly support virulence mechanisms. The genome of Salmonella enteritidis PT4 contains SPI-1 and SPI-2, which encode type III secretion systems (T3SS) critical for host cell invasion and intracellular survival . These secretion systems are complex membrane-spanning structures that depend on proper membrane organization and cell division processes.

As a probable septation protein, yciB may contribute to maintaining cellular integrity during bacterial replication within host environments, which is essential for establishing infection. The proper functioning of membrane proteins is crucial for the assembly and operation of virulence-associated secretion systems. Additionally, bacterial cell division is a critical process during infection, as it enables pathogen population expansion within the host. Therefore, septation proteins like yciB may indirectly influence virulence by supporting the bacterial cell cycle during infection progression. Comparative genomic studies with other Salmonella strains could further elucidate the relationship between yciB conservation and virulence capabilities across different serotypes.

How can knockout studies of yciB inform our understanding of Salmonella enteritidis pathogenesis?

Knockout studies targeting the yciB gene can provide valuable insights into its role in Salmonella enteritidis pathogenesis through several experimental approaches:

These approaches should be interpreted in the context of Salmonella enteritidis PT4's complex virulence strategies, including the functioning of its twelve pathogenicity islands and various virulence factors . The results would help position yciB within the broader pathogenicity framework of this clinically significant bacterial pathogen.

What is the relationship between yciB function and Salmonella biofilm formation capabilities?

The relationship between yciB function and Salmonella biofilm formation presents an intriguing research question, particularly given the findings that Salmonella enteritidis PT4 578 shows differential biofilm formation capabilities compared to related serotypes . While the specific role of yciB in biofilm formation is not directly established in the available literature, as a membrane protein involved in septation, it may influence several aspects of the biofilm development process:

• Cell division during biofilm maturation: Proper septation is crucial for bacterial proliferation within developing biofilms. Disruptions in yciB function might alter cell division dynamics, affecting biofilm architecture and stability.

• Membrane integrity and surface properties: As a membrane protein, yciB might influence bacterial surface characteristics that affect initial attachment to surfaces, a critical first step in biofilm formation.

• Stress response coordination: Biofilm formation is often a stress response mechanism. Membrane proteins can serve as environmental sensors or stress response mediators that trigger biofilm-associated developmental pathways.

The phenotypic characterization of Salmonella enteritidis PT4 578 revealed differences in the expression of the red, dry, and rough (rdar) morphotype and biofilm formation compared to other serotypes . This suggests that strain-specific factors, potentially including membrane proteins like yciB, may contribute to these phenotypic differences. Research examining the biofilm formation capabilities of yciB mutants under various environmental conditions would help clarify this relationship and potentially identify new targets for biofilm prevention strategies.

What challenges might researchers encounter when expressing and purifying recombinant yciB?

Researchers working with recombinant yciB face several technical challenges inherent to membrane protein research:

• Protein aggregation and inclusion body formation: Membrane proteins often aggregate during overexpression in heterologous systems like E. coli. To mitigate this, researchers should optimize expression conditions by:

  • Using lower induction temperatures (16-25°C)

  • Employing weaker promoters or lower inducer concentrations

  • Testing specialized E. coli strains designed for membrane protein expression (C41, C43, or Lemo21)

  • Including membrane-stabilizing additives in growth media

• Detergent selection complexity: Maintaining yciB solubility requires careful detergent selection. Different detergents should be screened to identify optimal conditions that preserve protein structure and function. Typically, initial extraction with stronger detergents followed by exchange to milder ones during purification yields better results.

• Purification yield limitations: Membrane proteins typically yield lower amounts compared to soluble proteins. Researchers should optimize each purification step, considering:

  • Efficient membrane solubilization conditions

  • Appropriate detergent concentrations throughout purification

  • Buffer optimization to prevent protein aggregation

  • The use of stabilizing additives like glycerol or specific lipids

• Protein stability issues: The recombinant yciB requires specific storage conditions to maintain stability. As noted in the product information, researchers should avoid repeated freeze-thaw cycles, store working aliquots at 4°C for limited periods (up to one week), and maintain long-term storage at -20°C/-80°C in the presence of glycerol .

These challenges necessitate careful experimental design and optimization when working with this membrane protein.

How can researchers validate the structural integrity and functionality of purified recombinant yciB?

Validating the structural integrity and functionality of purified recombinant yciB requires multiple complementary approaches:

• Biophysical characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content and proper folding

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity and oligomeric state

  • Thermal stability assays to determine protein stability in different buffer conditions

  • Intrinsic tryptophan fluorescence to monitor tertiary structure integrity

• Structural analysis:

  • Limited proteolysis to assess protein folding and domain organization

  • Hydrogen/deuterium exchange mass spectrometry to examine protein dynamics and solvent accessibility

  • Negative-stain electron microscopy to visualize protein particles and assess homogeneity

• Functional validation:

  • Liposome binding or integration assays to confirm membrane association properties

  • Reconstitution into nanodiscs followed by functional assays

  • In vitro septation assays using fluorescently labeled FtsZ (a key cell division protein) to assess yciB's ability to modulate septation processes

• Biochemical verification:

  • Western blotting using anti-His antibodies to confirm protein identity and integrity

  • Mass spectrometry to verify the full protein sequence and post-translational modifications

  • Binding studies with known interaction partners from Salmonella

When conducting these validations, researchers should compare results with appropriate controls, including denatured protein samples and related membrane proteins with known properties. Functional assays should be designed based on the predicted role of yciB in septation processes, keeping in mind that complete functional characterization may require complementary in vivo approaches.

What specific considerations should be addressed when using recombinant yciB in structural biology studies?

Structural biology studies of recombinant yciB require addressing several membrane protein-specific challenges:

• Sample preparation optimization:

  • Detergent screening is crucial for maintaining protein stability while providing a membrane-mimetic environment. A systematic approach testing different detergent classes (maltoside, glucoside, and fos-choline derivatives) is recommended.

  • Alternative membrane mimetics such as nanodiscs, amphipols, or lipidic cubic phases may provide more native-like environments for structural studies.

  • Buffer composition should be optimized to include stabilizing agents like glycerol, specific lipids, or mild reducing agents to prevent aggregation and oxidation.

• Crystallization considerations:

  • For X-ray crystallography, vapor diffusion methods with specialized screens for membrane proteins are recommended.

  • Lipidic cubic phase (LCP) crystallization may be particularly suitable for membrane proteins like yciB.

  • The presence of the His-tag may affect crystallization; studies with both tagged and tag-cleaved protein should be attempted.

• Cryo-EM preparation:

  • Grid preparation for membrane proteins requires careful optimization of protein concentration, detergent concentration, and vitrification conditions.

  • The relatively small size of yciB (179 amino acids) presents challenges for cryo-EM visualization; consider using antibody fragments or fusion partners to increase molecular weight.

• NMR approaches:

  • Solution NMR studies will require isotopic labeling (15N, 13C, 2H) of recombinant yciB expressed in minimal media.

  • Detergent micelle size must be optimized to allow for good spectral quality while maintaining protein stability.

  • Solid-state NMR of reconstituted yciB in lipid bilayers may provide complementary structural information.

• Data interpretation:

  • Structural data should be interpreted in the context of predicted transmembrane domains and potential functional regions.

  • Molecular dynamics simulations can help validate structural models and predict protein behavior in membrane environments.

These considerations will help researchers maximize the chances of success in structural biology studies of this challenging membrane protein target.

How might recombinant yciB be utilized in developing novel antimicrobial strategies against Salmonella?

Recombinant yciB offers several potential avenues for developing novel antimicrobial strategies against Salmonella enteritidis:

• Target-based drug discovery: If yciB is essential for bacterial viability or virulence, it could serve as a novel drug target. The recombinant protein enables:

  • High-throughput screening assays to identify small molecule inhibitors

  • Structure-based drug design approaches once three-dimensional structure is determined

  • Fragment-based screening to identify initial chemical matter for optimization

• Vaccine development approaches:

  • As a membrane protein, yciB or specific epitopes could be incorporated into subunit vaccine formulations

  • The recombinant protein allows for epitope mapping to identify immunogenic regions

  • Anti-yciB antibodies could be evaluated for protective efficacy in animal models

• Diagnostic tool development:

  • Recombinant yciB can serve as a standard for developing sensitive detection methods for Salmonella

  • Anti-yciB antibodies generated using the recombinant protein could be incorporated into diagnostic tests

  • The protein sequence could inform development of DNA-based diagnostic methods targeting the yciB gene

• Pathogenesis research:

  • The recombinant protein enables detailed investigations of yciB's role in cellular processes

  • Competitive inhibitors of yciB function could be developed as research tools to probe Salmonella pathogenesis

  • Understanding yciB's function could reveal new vulnerabilities in Salmonella's infection cycle

These approaches would complement current understanding of Salmonella virulence mechanisms, which involve multiple pathogenicity islands and secretion systems . By targeting membrane proteins like yciB, which may not be under the same selective pressure as known virulence factors, novel intervention strategies might circumvent existing resistance mechanisms.

What comparative genomics approaches can reveal about yciB conservation and evolution across Salmonella strains?

Comparative genomics approaches can provide valuable insights into yciB conservation and evolution across Salmonella strains through several methodological strategies:

• Sequence conservation analysis:

  • Multiple sequence alignment of yciB homologs across diverse Salmonella strains can identify conserved domains and variable regions

  • Calculation of selection pressure (dN/dS ratios) can reveal whether yciB is under purifying, neutral, or positive selection

  • Comparison of conservation patterns between pathogenic and non-pathogenic Salmonella strains may highlight virulence-associated features

• Synteny and genomic context examination:

  • Analysis of gene neighborhoods surrounding yciB can reveal conserved operonic structures or functional gene clusters

  • Identification of mobile genetic elements near yciB may indicate horizontal gene transfer events

  • Comparison with the genomic organization in Salmonella enteritidis PT4, which contains twelve pathogenicity islands , can place yciB in a broader genomic context

• Structural prediction comparisons:

  • Homology modeling of yciB across strains can identify structural conservation patterns

  • Prediction of transmembrane domains and topology across variants can reveal functionally constrained regions

  • Comparison of protein surface properties may highlight strain-specific adaptations

• Phylogenetic analysis:

  • Construction of phylogenetic trees based on yciB sequences can reveal evolutionary relationships

  • Comparison with species trees can identify potential horizontal gene transfer events

  • Ancestral sequence reconstruction can trace the evolutionary trajectory of specific protein domains

These approaches would contribute to understanding how yciB has evolved in the context of Salmonella adaptation to different hosts and environments, potentially revealing correlations with virulence capabilities, host specificity, or environmental persistence traits.

How can systems biology approaches integrate yciB function into broader models of Salmonella pathogenesis?

Systems biology approaches offer powerful frameworks for integrating yciB function into comprehensive models of Salmonella pathogenesis:

• Protein-protein interaction network analysis:

  • Identification of yciB interaction partners through experimental methods (pull-downs, crosslinking mass spectrometry)

  • Integration of these interactions into existing Salmonella protein interaction networks

  • Network analysis to position yciB within functional modules related to cell division, membrane organization, or virulence

• Multi-omics data integration:

  • Correlation of transcriptomic data (RNA-seq) from yciB mutants with proteomics and metabolomics profiles

  • Identification of metabolic pathways affected by yciB dysfunction

  • Integration with existing datasets on Salmonella enteritidis PT4, which has 165 genes (3.66% of coding sequences) encoding virulence factors

• Computational modeling approaches:

  • Incorporation of yciB function into agent-based models of bacterial septation and cell division

  • Development of differential equation models capturing membrane protein dynamics during infection

  • Integration into existing models of Salmonella pathogenesis, particularly focusing on the twelve pathogenicity islands and their regulation

• Host-pathogen interaction modeling:

  • Investigation of how yciB function affects Salmonella interaction with host cells

  • Analysis of how membrane protein organization influences secretion system assembly and function

  • Integration with models of biofilm formation, which has been shown to differ between Salmonella strains

• Evolutionary systems biology:

  • Analysis of yciB conservation in the context of broader genomic adaptations

  • Identification of co-evolving gene clusters that may function together

  • Prediction of strain-specific adaptations in membrane organization and cell division

These integrative approaches would position yciB within the broader context of Salmonella pathogenesis mechanisms, potentially revealing unexpected functional connections and providing a more comprehensive understanding of how this membrane protein contributes to bacterial physiology and virulence.