Recombinant Salmonella enteritidis PT4 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Genomic and Pathogenicity Context

In Salmonella enteritidis PT4 strain 578, the lgt gene resides within a genome of 4.68 Mb (52.2% GC content) alongside 12 Salmonella Pathogenicity Islands (SPIs) :

  • SPI-1 and SPI-2: Encode type III secretion systems (T3SS) essential for host cell invasion and intracellular survival.

  • Virulence factors: 165 genes (3.66% of coding sequences) linked to colonization, iron uptake (sitABCD), and immune evasion .

Comparative genomics with S. Typhimurium LT2 reveals >90% synteny, but S. Enteritidis PT4 carries unique prophage-associated genes (e.g., sseK3, sopE) that enhance adaptive virulence .

Biochemical Activity

Lgt is indispensable for lipoprotein maturation. Experimental studies in E. coli show:

  • Depletion leads to outer membrane destabilization, increased antibiotic sensitivity, and impaired biofilm formation .

  • Essential residues (Y26, N146, G154) are strictly conserved across Gram-negative bacteria, validating Lgt as a therapeutic target .

Role in Pathogenicity

  • Membrane integrity: Lgt-modified lipoproteins stabilize the outer membrane via peptidoglycan tethering (e.g., Lpp and Pal) .

  • Virulence regulation: SPI-1/SPI-2 effectors depend on functional lipoproteins for host cell manipulation .

Recombinant Production and Applications

The recombinant protein is produced in E. coli expression systems with a His-tag for purification . Key specifications include:

ParameterDetails
Expression HostE. coli
Purity>90% (SDS-PAGE verified)
StorageTris buffer, 50% glycerol; stable at -20°C/-80°C
ApplicationsEnzyme kinetics, inhibitor screening, structural studies

Inhibitor Development

Novel Lgt inhibitors (e.g., compound Lgt-2) exhibit:

  • In vitro IC₅₀: 0.8–1.2 µM against E. coli and Acinetobacter baumannii Lgt .

  • Bactericidal activity: Unlike downstream lipoprotein pathway inhibitors, Lgt blockers remain effective in lpp-deficient strains, circumventing common resistance mechanisms .

Comparative Phenomics

  • Biofilm formation: S. Enteritidis PT4 578 lacks the rdar morphotype despite genomic capacity, suggesting regulatory divergence .

  • Host adaptation: Pseudogene accumulation in S. Gallinarum (a PT4 descendant) highlights Lgt’s conserved role in broad-host pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; SEN2844; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links

KEGG: set:SEN2844

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what role does it play in Salmonella?

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein maturation. In Salmonella, Lgt transfers the diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in prolipoprotein signal sequences, resulting in a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . This lipid modification is crucial for proper anchoring of lipoproteins to the bacterial membrane. The reaction represents the first of three successive steps in the lipoprotein biogenesis pathway, followed by the actions of signal peptidase II (Lsp) and apolipoprotein N-acyltransferase (Lnt) .

How does the structure of Lgt contribute to its function?

Lgt is characterized by a complex membrane topology consisting of seven transmembrane segments with the N-terminus facing the periplasm and the C-terminus facing the cytoplasm . This structural arrangement positions highly conserved amino acids critical for enzymatic function within the membrane environment. Lgt contains a signature motif that faces the periplasmic side, which includes invariant residues essential for catalytic activity . This strategic positioning enables the enzyme to access both its phosphatidylglycerol substrate from the membrane and the prolipoprotein substrate from the translocation machinery, facilitating the diacylglyceryl transfer reaction within the membrane environment .

Why is Lgt considered a virulence factor in Salmonella infections?

Lgt plays a crucial role in Salmonella virulence by ensuring proper maturation of multiple lipoproteins involved in bacterial pathogenesis. Studies with lgt mutants have demonstrated that functional Lgt is required for effective host cell invasion, cytotoxicity, and induction of proinflammatory cytokines . The importance of Lgt in virulence is underscored by the finding that Salmonella strains with inactivated lgt genes show significantly attenuated virulence in mouse models . Additionally, lipoproteins processed by Lgt contribute to activation of host Toll-like receptor 2 (TLR2) signaling pathways, influencing the immune response during infection . The critical role of Lgt in maintaining bacterial membrane integrity and function also impacts multiple virulence-associated processes including motility and type III secretion system functionality .

How can researchers differentiate between the effects of Lgt and other lipoprotein-processing enzymes?

Researchers can differentiate between the effects of Lgt and other lipoprotein-processing enzymes through several methodological approaches:

  • Sequential mutant analysis: Creating individual knockout mutants for each enzyme in the lipoprotein processing pathway (Lgt, Lsp, Lnt) and comparing their phenotypes.

  • Biochemical analysis: Examining lipoprotein precursors that accumulate in specific mutants - Lgt mutants accumulate unmodified prolipoproteins, Lsp mutants accumulate diacylglyceryl-modified prolipoproteins, and Lnt mutants accumulate diacylglyceryl-modified apolipoproteins .

  • Complementation studies: Restoring individual enzymatic functions through gene complementation to verify specific roles.

  • In vitro enzymatic assays: Using purified enzymes and synthetic substrates to measure specific activities of each enzyme in isolation .

These approaches allow researchers to distinguish the unique contributions of Lgt from other enzymes in the lipoprotein processing pathway.

What are the critical amino acid residues for Lgt function and how do their mutations impact enzymatic activity?

Several highly conserved amino acid residues have been identified as critical for Lgt function through alanine substitution studies. Residues Y26, N146, and G154 are absolutely essential for Lgt enzymatic activity, while R143, E151, R239, and E243 play important supporting roles . Most of these critical residues are located within the transmembrane domains or the Lgt signature motif that faces the periplasm . The absolute requirement for these specific residues suggests their direct involvement in substrate binding, catalysis, or maintenance of proper protein conformation.

Mutation of the essential residues (Y26A, N146A, G154A) completely abolishes enzymatic activity, resulting in accumulation of unmodified prolipoproteins and significant disruption of membrane functions . Mutations in the supporting residues (R143A, E151A, R239A, E243A) result in partial retention of activity, suggesting their roles in optimizing rather than enabling catalysis . These findings provide valuable insights for structure-function relationships and potential targeting strategies for antimicrobial development.

How does deletion of lgt affect the pathogenesis of Salmonella in different infection models?

The deletion of lgt dramatically impacts Salmonella pathogenesis across multiple infection models:

Infection ModelEffects of lgt DeletionKey Observations
T84 intestinal epithelial cells500-1000 fold reduction in invasionCell binding unaffected; cytotoxicity reduced
RAW264.7 macrophagesReduced cytotoxicity; normal intracellular survivalDecreased proinflammatory cytokine production
Ovarian tumor cell line (A2780)Complete loss of invasionCell binding unaffected
Mouse modelComplete attenuation of virulenceProtection against subsequent wild-type challenge
SCID miceLethal infection despite lgt deletionSuggests critical role of adaptive immunity in protection

Interestingly, even deletion of a single lgt copy (either lpp1 or lpp2 in Salmonella Typhimurium) is sufficient to render the bacteria avirulent in mice . This finding highlights the non-redundant nature of lgt genes despite their sequence similarity and underscores their critical importance in Salmonella pathogenesis. The complementation of the lgt double-knockout mutant restores virulence, confirming the specific role of Lgt in pathogenesis rather than polar effects from gene deletion .

What is the relationship between Lgt activity and host inflammatory responses during Salmonella infection?

Lgt plays a significant role in modulating host inflammatory responses during Salmonella infection through its effects on lipoprotein maturation. Studies have demonstrated that lgt-deficient Salmonella mutants induce significantly reduced levels of proinflammatory cytokines, including tumor necrosis factor alpha (TNF-α) and interleukin-8 (IL-8), in both macrophages and intestinal epithelial cells . This reduction in cytokine production occurs despite normal binding of bacteria to host cells, suggesting that mature lipoproteins are directly involved in immunostimulation.

The immunomodulatory effect of Lgt appears to be mediated primarily through Toll-like receptor 2 (TLR2) signaling pathways . Experiments with heat-killed wild-type and lgt mutant Salmonella have shown that invasion is not required for IL-8 production, indicating that surface-exposed lipoproteins processed by Lgt directly interact with host pattern recognition receptors . This relationship between Lgt activity and inflammatory responses has important implications for understanding Salmonella pathophysiology and developing targeted intervention strategies.

How can recombinant Lgt be utilized to develop attenuated Salmonella vaccine strains?

Recombinant Lgt technology offers several strategic approaches for developing attenuated Salmonella vaccine strains:

  • Conditional expression systems: Engineering recombinant lgt under inducible promoters allows for controlled attenuation during vaccine production and delivery.

  • Site-directed mutagenesis: Creating recombinant Lgt variants with reduced but not abolished activity through targeted mutations in critical residues (R143, E151, R239, E243) can produce partially attenuated strains with balanced immunogenicity and safety profiles .

  • Immune response optimization: Modifying Lgt to specifically enhance processing of immunogenic lipoproteins while reducing activity toward lipoproteins involved in virulence.

  • Cross-protective antigen presentation: Using attenuated lgt mutants as vectors for delivering heterologous antigens from other pathogens.

The demonstrated protection of mice infected with lgt-deficient Salmonella against subsequent wild-type challenge provides proof-of-concept for the vaccine potential of these attenuated strains . Furthermore, the finding that SCID mice remain susceptible to lgt mutants indicates that protective immunity requires adaptive immune responses, supporting the vaccine application of these strains .

What are the optimal conditions for expressing and purifying recombinant Salmonella enteritidis PT4 Lgt?

Optimal expression and purification of recombinant Salmonella enteritidis PT4 Lgt requires specialized approaches due to its transmembrane nature:

  • Expression systems: E. coli C41(DE3) or C43(DE3) strains are recommended for membrane protein expression. The pET or pBAD vector systems with tunable induction provide controlled expression to prevent toxicity.

  • Growth conditions: Cultivation at lower temperatures (16-20°C) after induction, with reduced inducer concentrations (0.1-0.5 mM IPTG or 0.002-0.02% arabinose) enhances proper folding and membrane integration.

  • Membrane extraction: Gentle detergent solubilization using non-ionic detergents (DDM, LDAO, or Triton X-100) at concentrations slightly above their critical micelle concentration preserves enzyme structure and function.

  • Purification strategy: Affinity chromatography using N- or C-terminal His-tags followed by size exclusion chromatography in detergent-containing buffers yields the highest purity.

  • Activity preservation: Addition of phospholipids (particularly phosphatidylglycerol) to purification buffers helps maintain enzymatic activity by providing stabilizing native-like environment .

These conditions can be optimized further based on specific experimental requirements and the intended application of the purified protein.

What methods can researchers use to create and validate lgt knockout mutants in Salmonella enteritidis PT4?

Creating and validating lgt knockout mutants in Salmonella enteritidis PT4 requires a systematic approach:

  • Knockout strategy selection:

    • Marker exchange mutagenesis using antibiotic resistance cassettes (kanamycin or chloramphenicol) flanked by homologous regions to the target lgt gene .

    • Lambda Red recombinase system for precise in-frame deletions without antibiotic markers.

    • CRISPR-Cas9 targeted mutagenesis for scarless genome editing.

  • Construct preparation:

    • PCR amplification of regions flanking the lgt gene (~1 kb on each side).

    • Incorporation of restriction sites for cloning into suicide vectors (e.g., pRE112, pKNG101).

    • Sequence verification of the construct before transformation.

  • Mutant generation:

    • Two-step allelic exchange using sucrose sensitivity (sacB) or temperature sensitivity for counterselection.

    • Selection of transformants on appropriate antibiotic media.

    • Screening for double crossover events through antibiotic resistance patterns.

  • Validation approaches:

    • PCR verification using primers spanning the deletion junction.

    • Southern blot analysis to confirm genetic organization.

    • RT-PCR or RNA-seq to verify absence of lgt transcripts.

    • Western blot analysis using anti-Lgt antibodies.

    • Functional validation by assessing accumulation of unmodified prolipoproteins .

    • Complementation studies to confirm phenotype specificity .

Successful creation and validation of lgt knockout mutants provide essential tools for investigating the role of Lgt in Salmonella virulence and pathogenesis.

What assays can be used to measure Lgt enzymatic activity in vitro?

Several assays have been developed to measure Lgt enzymatic activity in vitro:

  • Radioactive assay using labeled phosphatidylglycerol: This traditional approach measures the transfer of radioactively labeled diacylglyceryl groups ([2-³H]glycerol or [9,10-³H]palmitate) from phosphatidylglycerol to synthetic peptide substrates corresponding to prolipoprotein signal sequences . The peptide MKATKLVLGAVILGSTLLAGCSSN, derived from Braun's prolipoprotein, serves as an effective substrate .

  • HPLC-based assay: Separates and quantifies the reaction products (modified peptide and sn-glycerol 1-phosphate) using reversed-phase HPLC, offering improved sensitivity without radioactive materials.

  • Fluorescence resonance energy transfer (FRET)-based assay: Utilizes peptide substrates labeled with fluorophore-quencher pairs that change fluorescence properties upon diacylglyceryl modification.

  • Mass spectrometry assay: Directly detects the mass shift in the peptide substrate following diacylglyceryl modification, providing both qualitative and quantitative information.

  • Coupled enzymatic assay: Measures the production of sn-glycerol 1-phosphate (the reaction by-product) through coupling with glycerol 3-phosphate dehydrogenase and spectrophotometric detection of NADH production .

These assays enable detailed kinetic analysis of wild-type and mutant Lgt enzymes, facilitating structure-function studies and inhibitor screening.

How can researchers assess the impact of lgt modifications on Salmonella virulence?

Researchers can employ multiple complementary approaches to assess the impact of lgt modifications on Salmonella virulence:

  • In vitro cellular models:

    • Invasion assays using intestinal epithelial cell lines (T84, Caco-2) to quantify bacterial entry .

    • Cytotoxicity assays measuring host cell damage through LDH release or MTT reduction .

    • Macrophage survival assays to assess intracellular replication and persistence .

    • Proinflammatory cytokine production (TNF-α, IL-8) as indicators of immunostimulatory capacity .

  • Ex vivo tissue models:

    • Intestinal organoids to evaluate tissue-specific interactions.

    • Precision-cut lung slices for respiratory infection models.

  • In vivo animal models:

    • Mouse infection models using different routes (oral, intraperitoneal, intravenous) .

    • Competitive index assays comparing wild-type and modified strains in mixed infections.

    • Survival curves and bacterial burden in tissues to quantify virulence attenuation .

    • Immune response characterization (antibody production, T-cell responses).

    • Protection studies against subsequent wild-type challenge .

  • Mechanistic analyses:

    • Motility assays to assess flagellar function .

    • Type III secretion system activity evaluation .

    • Membrane integrity assessment through permeability assays.

    • Lipidomic and proteomic analyses of membrane composition.

The water contamination delivery method represents a natural infection approach that more closely mimics physiological conditions compared to gavage needle delivery, potentially providing more relevant virulence assessment .

What are the most effective experimental infection models for studying recombinant Salmonella enteritidis PT4 Lgt mutants?

When studying recombinant Salmonella enteritidis PT4 Lgt mutants, researchers should consider several infection models, each offering distinct advantages:

  • Laboratory animal models:

    • C57BL/6 mice provide a well-characterized genetic background for reproducible results .

    • BALB/c mice offer an alternative genetic background with different susceptibility profiles.

    • SCID mice help distinguish between innate and adaptive immune contributions to protection .

    • Streptomycin-pretreated mouse model enhances intestinal colonization for studying gastroenteritis.

  • Infection delivery methods:

    • Water contamination delivery provides a natural, less stressful infection route that effectively models natural exposure .

    • Oral gavage with sodium bicarbonate pretreatment ensures precise dosing but introduces artificial stress .

    • Intraperitoneal injection bypasses intestinal barriers for systemic infection studies.

  • Specialized models:

    • Chicken models for studying Salmonella enteritidis PT4 in its natural host.

    • Ligated ileal loop model for studying local intestinal responses.

    • Humanized mouse models with human microbiota for improved translational relevance .

Research indicates that water contamination delivery of Salmonella is equivalent to gavage inoculation in providing a consistent model of infection . Importantly, exposure to contaminated drinking water for as little as 4 hours allows maximal mucosal and systemic infection, suggesting an abbreviated window exists for natural intestinal entry . This finding has important implications for experimental design when studying lgt mutants.

What are the emerging research areas for Recombinant Salmonella enteritidis PT4 Lgt?

Emerging research areas for Recombinant Salmonella enteritidis PT4 Lgt include several promising directions:

  • Structural biology approaches: Cryo-electron microscopy and X-ray crystallography studies of Lgt to elucidate precise catalytic mechanisms and substrate binding sites . This structural information would complement the current knowledge of transmembrane topology and essential residues.

  • Development of specific inhibitors: Rational design of Lgt inhibitors based on structure-activity relationships with potential therapeutic applications as novel antimicrobials . The essential nature of Lgt makes it an attractive target for drug development.

  • Vaccine vector engineering: Optimization of lgt-attenuated Salmonella strains as vectors for heterologous antigen delivery, utilizing their ability to stimulate both mucosal and systemic immunity . The demonstrated protection against challenge in mouse models provides a foundation for vaccine development.

  • Microbiome interactions: Investigation of how lgt-modified Salmonella interacts with the gut microbiota during infection and colonization . This includes studying competitive advantages and disadvantages in the complex intestinal ecosystem.

  • Comparative genomics: Analysis of lgt gene variations across Salmonella serovars and their correlation with host specificity and virulence patterns. This approach could reveal evolutionary adaptations in lipoprotein processing systems.

These research directions promise to expand our understanding of Lgt biology while developing practical applications in medicine and biotechnology.

How might CRISPR-Cas9 technology advance research on Salmonella enteritidis PT4 Lgt?

CRISPR-Cas9 technology offers transformative approaches for advancing Lgt research:

  • Precise genome editing: Creation of scarless, markerless mutations in lgt gene with minimal off-target effects, allowing subtle modifications such as single amino acid substitutions to map structure-function relationships .

  • Regulatory element manipulation: Targeted modifications of lgt promoters and regulatory regions to study expression control mechanisms and their impact on virulence.

  • CRISPRi applications: Deployment of CRISPR interference for conditional and tunable repression of lgt expression, enabling temporal control of Lgt activity during different infection stages.

  • High-throughput mutagenesis: Implementation of CRISPR library screens to systematically identify genetic interactions with lgt and discover synthetic lethal partners.

  • In vivo editing: Development of techniques for direct editing of lgt in Salmonella during infection to study temporal requirements for Lgt activity in pathogenesis.

These CRISPR-based approaches overcome limitations of traditional genetic manipulation techniques, offering unprecedented precision and efficiency in studying the complex roles of Lgt in Salmonella biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.