Recombinant Salmonella enteritidis PT4 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Definition and Identification of Recombinant Salmonella enteritidis PT4 Protein CrcB Homolog (crcB)

The Recombinant Salmonella enteritidis PT4 Protein CrcB homolog (crcB) is a synthetic version of the native CrcB protein produced in heterologous expression systems. It originates from Salmonella enteritidis PT4 strain P125109 (Uniprot ID: B5QVN1), with the gene located at locus SEN0599 . This 127-amino-acid protein (mLQLLLAVFIGGGTGSVARWmLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR) is homologous to bacterial carbon catabolite repression (CrcB) proteins, though its specific functional role in S. enteritidis remains under investigation .

Primary Sequence and Domains

The protein’s sequence spans residues 1–127, with a predicted molecular weight of ~14.3 kDa. Key structural features include:

  • N-terminal signal peptide: Likely involved in protein localization or secretion (residues 1–20).

  • Core region: Contains conserved motifs associated with nucleic acid binding or regulatory functions (e.g., residues 50–100) .

Key Identifiers

IdentifierDetails
Uniprot IDB5QVN1
Locus NameSEN0599
StrainP125109
Length127 amino acids

Genomic Context of S. enteritidis PT4

Strain P125109 is part of a lineage closely related to S. Gallinarum, a host-adapted poultry pathogen . Key genomic features include:

  • Pathogenicity Islands (SPIs): SPI-1, SPI-2, and SPI-6, encoding type III secretion systems critical for host invasion .

  • CRISPR-Cas Systems: Two loci (CRISPR1, CRISPR2) with protospacers targeting plasmids and phages .

  • Restriction-Modification Systems: Three types (I, II, III) for genomic defense .

Diagnostic and Vaccine Development

ApplicationDetails
ELISA AssaysUsed as an antigen for detecting anti-Salmonella antibodies .
Vaccine CandidatesInvestigated for immunogenicity in vaccine formulations targeting S. enteritidis .

Expression Systems and Purification

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells .
Purity≥85% (SDS-PAGE confirmed) .
Storage-20°C (avoid repeated freeze-thaw cycles) .

Product Variability

  • Tag Information: N-terminal/C-terminal tags vary by manufacturer (e.g., His-tag, GST) .

  • Endotoxin Levels: Low-endotoxin formulations available upon request .

Genomic Insights

  • Host Adaptation: S. enteritidis PT4 shares >99.7% nucleotide identity with S. Gallinarum, but retains functional genes lost in the latter (e.g., fimbrial operons) .

  • Biofilm Deficiency: Despite genomic potential, PT4 lacks the rdar morphotype, indicating regulatory or environmental factors influencing biofilm formation .

Unresolved Questions

  • Mechanistic Role: No studies directly link CrcB to virulence or metabolic regulation in S. enteritidis.

  • Immunogenicity: Limited data on its efficacy as a vaccine antigen or serodiagnostic marker.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; SEN0599; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: set:SEN0599

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the crcB gene in Salmonella enteritidis PT4?

The crcB gene in S. enteritidis PT4 can be analyzed through the complete genome sequence available under EMBL accession number AM933172 . While the specific genomic neighborhood of crcB is not directly detailed in available research, the gene likely exists within the core genome regions that show high conservation across Salmonella strains. Genomic analysis comparing S. enteritidis PT4 with other sequenced strains like S. Typhimurium LT2 reveals that over 90% of coding sequences form an extensive core gene set with an average nucleotide identity of 98.98% between shared orthologs .

To properly characterize the genomic context, researchers should:

  • Perform comparative genomic analysis across multiple Salmonella strains

  • Identify conserved synteny in regions flanking the crcB gene

  • Analyze operon structures and potential co-transcribed genes

  • Examine upstream regulatory regions for promoter elements and transcription factor binding sites

How is the crcB gene identified and annotated in the S. enteritidis PT4 genome?

The methodological approach includes:

  • Sequence-based identification using BLAST searches against known crcB homologs from related bacteria

  • Gene prediction algorithms to identify open reading frames with characteristics matching known crcB genes

  • Comparative genomic analysis between S. enteritidis PT4 and related strains like S. Typhimurium LT2, which share >90% of coding sequences in their core genomes

  • Protein domain analysis to identify conserved functional domains characteristic of CrcB proteins

  • Experimental validation through:

    • RT-PCR to confirm transcription

    • Targeted mutagenesis similar to methods used for other S. enteritidis genes, as demonstrated with the hcp gene

    • Complementation studies to verify gene function

The annotation process should consider both sequence similarity and functional characteristics to ensure accurate identification of the crcB gene within the S. enteritidis PT4 genome.

What is known about the structure and function of CrcB homologs in bacteria?

CrcB homologs in bacteria are generally recognized as membrane proteins involved in fluoride ion export, serving as a protective mechanism against fluoride toxicity. While the specific CrcB homolog in S. enteritidis PT4 has not been extensively characterized in the available research, general knowledge about bacterial CrcB proteins provides insight into its likely structure and function.

CrcB proteins typically:

  • Function as fluoride ion channels or transporters

  • Contain multiple transmembrane domains forming a channel structure

  • Operate as dimers or tetramers in the bacterial membrane

  • Provide resistance to environmental fluoride, which can inhibit enzymes containing magnesium cofactors

The function of CrcB as a fluoride exporter can be experimentally assessed through fluoride sensitivity assays, similar to other phenotypic characterizations in S. enteritidis. For example, experimental approaches like those used to study the hcp gene in S. enteritidis MY1, where growth curves and cellular invasion were measured to assess functional impacts , could be adapted to study CrcB function.

How does recombination affect the evolution of the crcB gene in Salmonella enterica populations?

Recombination plays a significant role in shaping the evolution of genes within the Salmonella enterica genome, potentially including the crcB gene. Analysis of S. enterica populations has revealed that recombination and mutation have approximately equal effects in introducing polymorphism, with a ratio of rates (r/m) at which substitutions are introduced by recombination and mutation of approximately 1.14 (95% CI [1.06, 1.23]) .

Recombination in S. enterica typically affects segments of approximately 1826 bp on average (95% CI[1670][1980]) , which is sufficient to encompass entire genes like crcB. The impact of recombination varies significantly across different lineages of S. enterica:

LineageRecombination/Mutation relative effect (r/m)
10.20
22.17
32.95
40.82
50.15

As shown in the table above, lineages 2 and 3 experience significantly higher rates of recombination relative to mutation compared to lineages 1 and 5 . This differential recombination frequency could lead to varying evolutionary trajectories for genes like crcB depending on the lineage in which they reside.

To specifically study how recombination affects crcB evolution, researchers should:

  • Sequence the crcB gene across multiple S. enterica isolates from different lineages

  • Apply computational methods like ClonalFrame to detect recombination events

  • Compare recombination boundaries with gene boundaries to determine if crcB is typically transferred as a complete unit or fragmented

  • Assess whether recombination introduces adaptive changes to the crcB sequence

What is the evolutionary relationship between the CrcB homolog in S. enteritidis PT4 and other Salmonella strains?

The evolutionary relationship of the CrcB homolog across Salmonella strains can be understood within the broader context of Salmonella enterica evolution. Genome analysis has revealed that S. enteritidis PT4 and S. Gallinarum 287/91 share extensive genomic similarity, with S. Gallinarum being a recently evolved descendant of S. enteritidis . This close relationship suggests their CrcB homologs likely share high sequence identity.

When comparing S. enteritidis PT4 with S. Typhimurium LT2, the genomes show >90% of coding sequences forming an extensive core gene-set with average nucleotide identity between shared orthologs of 98.98% . This high conservation suggests that core genomic elements, potentially including crcB, maintain significant sequence similarity across these serovars.

Population structure analysis of S. enterica has identified five clear lineages with varying ages relative to the most recent common ancestor (TMRCA) of S. enterica:

LineageAge relative to TMRCA of S. enterica
10.15
20.20
30.66
40.23
50.08

Lineage 3 is particularly ancient, dating back to 66% of the age of the entire S. enterica subspecies . The distribution of crcB sequence variants across these lineages would provide insight into its evolutionary history and conservation.

To specifically study CrcB evolution across Salmonella strains, researchers should:

  • Extract and align crcB sequences from multiple Salmonella strains

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Calculate selection pressures (dN/dS ratios) to identify conserved functional domains

  • Compare crcB phylogeny with species phylogeny to detect potential horizontal gene transfer events

How can recombinant S. enteritidis PT4 CrcB protein be effectively expressed and purified?

Expressing and purifying recombinant S. enteritidis PT4 CrcB protein requires a systematic approach optimized for membrane proteins. Based on methodologies used for similar bacterial proteins, the following protocol would be effective:

  • Gene cloning and vector construction:

    • Amplify the crcB gene from S. enteritidis PT4 genomic DNA using PCR with primers containing appropriate restriction sites

    • Clone into an expression vector with an affinity tag (His6, FLAG, or MBP) for purification

    • Consider fusion tags that enhance membrane protein solubility (SUMO, MBP, or Mistic)

  • Expression system selection:

    • Use specialized E. coli strains designed for membrane protein expression (C41/C43 or Lemo21)

    • Consider alternative hosts like Pichia pastoris for difficult-to-express proteins

  • Optimization of expression conditions:

    • Test various induction temperatures (16-30°C), typically lower temperatures improve folding

    • Optimize inducer concentration (0.1-1.0 mM IPTG for E. coli)

    • Test different induction durations (4-24 hours)

    • Consider specialized media formulations with optimized osmolytes

  • Membrane extraction and solubilization:

    • Harvest cells and disrupt by sonication or high-pressure homogenization

    • Isolate membrane fractions by ultracentrifugation

    • Screen detergents for optimal solubilization (DDM, LDAO, or C12E8)

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) as initial purification step

    • Size exclusion chromatography to remove aggregates and achieve high purity

    • Consider ion exchange chromatography for additional purification if needed

  • Protein quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Circular dichroism to verify secondary structure integrity

    • Dynamic light scattering to assess homogeneity

    • Functional assays to confirm fluoride transport activity

For maintenance of protein stability throughout the purification process, include appropriate detergent concentrations above their critical micelle concentration in all buffers.

What techniques are available for studying CrcB function in S. enteritidis PT4?

Multiple complementary techniques can be employed to study CrcB function in S. enteritidis PT4, focusing on its presumed role in fluoride transport and resistance:

  • Genetic manipulation approaches:

    • Generate crcB knockout mutants using homologous recombination or CRISPR-Cas9, similar to methods used for creating the hcp mutant in S. enteritidis MY1

    • Construct complementation strains expressing wild-type or mutated crcB variants

    • Create reporter fusions to study gene expression under various conditions

  • Phenotypic characterization:

    • Growth assays in media containing varying fluoride concentrations

    • Competition assays between wild-type and ΔcrcB strains under fluoride stress

    • Membrane potential measurements to assess ion transport effects

    • Cell morphology analysis under fluoride stress conditions

  • Direct transport measurements:

    • Fluoride-specific electrode assays to measure changes in extracellular fluoride

    • Fluoride-sensitive fluorescent probes to monitor intracellular fluoride levels

    • Isotope (18F) flux experiments for quantitative transport kinetics

    • Preparation of membrane vesicles for controlled transport studies

  • Structural and interaction studies:

    • Protein-protein interaction analysis using bacterial two-hybrid systems

    • Co-immunoprecipitation to identify interaction partners

    • Cryo-electron microscopy for structural determination

    • Site-directed mutagenesis of predicted functional residues

  • Transcriptomic and proteomic approaches:

    • RNA-seq to identify genes co-regulated with crcB or affected by crcB deletion

    • Proteomics to detect changes in protein expression in response to crcB manipulation

    • ChIP-seq to identify transcription factors regulating crcB expression

Integration of these methodologies would provide comprehensive insights into CrcB function, regulation, and its role in S. enteritidis PT4 physiology.

How can CRISPR-Cas9 gene editing be utilized to study crcB function in S. enteritidis PT4?

CRISPR-Cas9 gene editing provides a powerful approach to study crcB function in S. enteritidis PT4 through precise genetic manipulation. The methodology can be implemented as follows:

  • gRNA design and validation:

    • Design guide RNAs (gRNAs) targeting specific regions of the crcB gene

    • Ensure specificity by checking for off-target binding sites in the S. enteritidis PT4 genome

    • Validate gRNA efficiency using in vitro cleavage assays

  • CRISPR-Cas9 delivery system:

    • Construct a plasmid containing both Cas9 and the gRNA expression cassettes

    • Use temperature-sensitive plasmids for transient expression

    • Consider alternative delivery methods like conjugation or electroporation

  • Gene modification strategies:

    • For gene knockout: induce double-strand breaks without providing a repair template

    • For precise modifications: co-deliver a repair template containing desired mutations flanked by homology arms

    • For gene regulation without editing: use catalytically inactive Cas9 (dCas9) fused to activator or repressor domains

  • Mutant selection and verification:

    • Design selection strategies based on phenotypic changes or co-delivered markers

    • Verify mutations by PCR and sequencing

    • Confirm single clonality of isolated mutants

  • Functional analysis of generated mutants:

    • Compare growth in the presence of fluoride between wild-type and mutant strains

    • Measure fluoride sensitivity and transport capabilities

    • Assess broader phenotypic changes including membrane integrity, stress response, and virulence properties

  • Complementation studies:

    • Reintroduce wild-type crcB to confirm phenotype specificity

    • Introduce point mutations to identify critical functional residues

    • Express crcB orthologs from other bacteria to test functional conservation

This CRISPR-based approach offers advantages over traditional mutagenesis methods, including higher efficiency, greater precision, and the ability to create scarless mutations without introducing antibiotic resistance markers.

What role might CrcB play in S. enteritidis PT4 virulence and host interaction?

The potential role of CrcB in S. enteritidis PT4 virulence can be investigated through systematic analysis of host-pathogen interactions. While the direct role of CrcB in virulence has not been established in the available research, methodological approaches similar to those used for studying other S. enteritidis genes can be applied.

To investigate CrcB's role in virulence:

  • In vitro cellular infection models:

    • Generate a crcB deletion mutant using methods similar to those described for the hcp mutant in S. enteritidis MY1

    • Compare adhesion and invasion capabilities between wild-type and ΔcrcB strains using cellular models like duck granulosa cells (dGCs) as described for hcp studies

    • Measure bacterial survival within host cells and assess cytotoxic effects

  • Virulence factor expression analysis:

    • Use qRT-PCR to analyze changes in expression of known virulence factors in the crcB mutant, similar to the approach used for the hcp mutant where expression of genes like invA, sipB, and hilA was measured

    • Perform RNA-seq to identify broader transcriptional changes affecting virulence pathways

    • Analyze protein secretion profiles, particularly for Type III secretion system effectors

  • Animal infection models:

    • Use established chicken or mouse models for S. enteritidis infection

    • Compare colonization levels, tissue distribution, and disease progression

    • Measure inflammatory responses and immune cell recruitment

  • Mechanistic investigations:

    • Assess whether CrcB affects the function of Salmonella pathogenicity islands (SPIs), which contain critical virulence genes

    • Investigate potential roles in stress resistance during host infection

    • Examine the relationship between fluoride homeostasis and virulence factor expression

If CrcB is found to influence virulence, it could represent a potential target for developing new control strategies against S. enteritidis PT4 infections.

How can knowledge of CrcB function be applied to develop novel antimicrobial strategies?

Understanding CrcB function in S. enteritidis PT4 could inform the development of novel antimicrobial strategies through several research pathways:

  • Target validation approaches:

    • Confirm that CrcB inhibition reduces bacterial survival under relevant conditions

    • Determine whether CrcB is essential during infection using conditional mutants

    • Assess conservation of CrcB across clinically relevant Salmonella strains

  • Inhibitor discovery strategies:

    • Develop high-throughput screening assays measuring:

      • Fluoride sensitivity in bacterial cultures with potential inhibitors

      • Direct fluoride transport inhibition in membrane vesicles

    • Perform virtual screening against CrcB structural models

    • Design rationally-based inhibitors targeting critical functional residues

  • Alternative approaches targeting CrcB function:

    • Develop compounds that increase intracellular fluoride concentration

    • Design molecules disrupting CrcB oligomerization or protein-protein interactions

    • Create antisense oligonucleotides targeting crcB expression

  • Combination therapy development:

    • Test synergy between CrcB inhibitors and conventional antibiotics

    • Evaluate combination with host immune modulators

    • Assess potential for reducing antibiotic resistance development

  • Delivery systems for CrcB-targeted therapeutics:

    • Develop nanoparticle formulations for targeted delivery

    • Explore the use of bacteriophages as delivery vehicles

    • Create prodrug approaches activated by bacterial enzymes

Similar approaches have been successfully applied to other bacterial targets, as demonstrated in the Salmonella field where attenuated S. typhi strains have been engineered to deliver therapeutic molecules like siRNA against multidrug resistance genes . This precedent suggests that targeted approaches based on CrcB function could yield promising antimicrobial strategies.

How does environmental fluoride exposure influence crcB expression and function in S. enteritidis PT4?

Environmental fluoride exposure likely has significant effects on crcB expression and function in S. enteritidis PT4, though this relationship has not been directly characterized in the available research. Based on knowledge of bacterial fluoride response systems, the following methodological approaches would elucidate this relationship:

  • Transcriptional regulation analysis:

    • Quantify crcB expression levels under varying fluoride concentrations using qRT-PCR

    • Use reporter gene fusions (like lacZ or gfp) to monitor crcB promoter activity in real-time

    • Perform 5' RACE to identify transcription start sites and potential regulatory elements

    • Apply ChIP-seq to identify transcription factors that regulate crcB in response to fluoride

  • Promoter analysis:

    • Create a series of promoter truncations to identify minimal regulatory regions

    • Use site-directed mutagenesis to confirm roles of predicted regulatory elements

    • Compare promoter sequences across Salmonella strains from environments with different fluoride levels

  • Adaptation studies:

    • Perform experimental evolution under increasing fluoride concentrations

    • Sequence evolved strains to identify adaptive mutations in crcB or regulatory elements

    • Measure fitness costs of crcB overexpression in low-fluoride environments

  • Protein function characterization:

    • Measure fluoride transport kinetics at different environmental fluoride concentrations

    • Assess protein stability and degradation rates under varying conditions

    • Investigate post-translational modifications that might regulate CrcB activity

  • Ecological relevance assessment:

    • Compare crcB sequences and expression levels in isolates from environments with naturally varying fluoride concentrations

    • Investigate correlations between environmental fluoride levels and Salmonella prevalence in field studies

Understanding how S. enteritidis PT4 regulates crcB in response to environmental fluoride could provide insights into bacterial adaptation mechanisms and potential vulnerabilities that could be exploited for control strategies.

How can conflicting data on CrcB function in different Salmonella strains be reconciled?

Reconciling conflicting data on CrcB function across different Salmonella strains requires systematic analysis of potential sources of variation and standardized experimental approaches:

  • Genetic context analysis:

    • Compare complete genome sequences to identify strain-specific genetic differences

    • Analyze the genomic neighborhood of crcB across strains, considering that S. enteritidis PT4 and S. Typhimurium LT2 share >90% of coding sequences but have significant genomic differences

    • Determine if crcB alleles differ across strains or if regulatory elements vary

  • Evolutionary considerations:

    • Place the strains within the five major lineages of S. enterica identified through population structure analysis

    • Consider that different lineages have varying rates of recombination (r/m ranging from 0.15 to 2.95) , which might affect the evolution of crcB and associated genes

    • Determine if apparent functional differences correlate with evolutionary relationships

  • Methodological standardization:

    • Develop uniform protocols for measuring CrcB function across strains

    • Test multiple strains simultaneously under identical conditions

    • Consider environmental variables that might affect results (media composition, growth phase, etc.)

  • Functional complementation studies:

    • Express crcB from different strains in a common genetic background

    • Assess whether functional differences persist when expression levels are normalized

    • Create chimeric proteins to identify domains responsible for functional differences

  • Systems biology approaches:

    • Analyze transcriptomic and proteomic data to identify strain-specific networks affecting CrcB function

    • Develop mathematical models incorporating strain-specific parameters

    • Use network analysis to identify compensatory mechanisms in different genetic backgrounds

This multi-faceted approach acknowledges that apparent contradictions often reflect incomplete understanding rather than truly incompatible data, and seeks to build a unified model of CrcB function that accommodates strain-specific variations.

What bioinformatic approaches are most effective for predicting CrcB structure and interactions?

Effective bioinformatic prediction of CrcB structure and interactions requires an integrated computational approach combining multiple methods:

  • Sequence-based analysis:

    • Apply sensitive homology detection using PSI-BLAST or HMM-based methods

    • Perform multiple sequence alignment to identify conserved residues

    • Use evolutionary analysis to place S. enteritidis PT4 CrcB in context of bacterial phylogeny

    • Apply methods similar to those used in S. enterica population structure analysis

  • Structural prediction methods:

    • Deploy AI-based methods like AlphaFold2 or RoseTTAFold for initial structural models

    • Refine predictions using molecular dynamics simulations in membrane environments

    • Validate predictions through comparison with experimental data from related proteins

    • Identify potential ion channels and binding sites

  • Functional site prediction:

    • Analyze conservation patterns to identify functionally important residues

    • Calculate selection pressure (dN/dS ratios) to detect regions under evolutionary constraint

    • Use computational docking to predict fluoride binding sites

    • Predict post-translational modification sites that might regulate function

  • Protein-protein interaction prediction:

    • Apply co-evolution analysis methods to identify potential interaction partners

    • Use protein docking simulations to model complex formation

    • Predict interaction interfaces based on surface properties and conservation

    • Integrate with genomic context information to identify potential functional associations

  • Integration of predictions with experimental validation planning:

    • Identify critical residues for site-directed mutagenesis

    • Design truncation constructs to test domain functions

    • Develop strategies for validating predicted interactions

This comprehensive bioinformatic approach would provide testable hypotheses about CrcB structure and function that could guide experimental studies, similar to how computational methods have informed understanding of recombination patterns in S. enterica .

How can transcriptomic data be analyzed to understand CrcB's role in stress response networks?

Analyzing transcriptomic data to understand CrcB's role in S. enteritidis PT4 stress response networks requires a systematic approach integrating bioinformatics and experimental validation:

  • Experimental design for transcriptomic analysis:

    • Compare gene expression profiles between wild-type and crcB mutant strains

    • Test multiple stress conditions, particularly fluoride exposure but also acid, oxidative, and osmotic stress

    • Include time-course experiments to capture dynamic responses

    • Use biological replicates to ensure statistical robustness

  • Data processing and quality control:

    • Perform standard RNA-seq preprocessing (adapter trimming, quality filtering)

    • Align reads to the S. enteritidis PT4 reference genome (EMBL accession no. AM933172)

    • Normalize data to account for sequencing depth and RNA composition

    • Apply batch correction if necessary

  • Differential expression analysis:

    • Identify genes significantly altered in the crcB mutant compared to wild-type

    • Apply appropriate statistical methods with false discovery rate control

    • Create volcano plots highlighting the most significant changes

    • Perform cluster analysis to identify co-regulated gene sets

  • Functional interpretation:

    • Conduct Gene Ontology and pathway enrichment analysis

    • Map differentially expressed genes onto known stress response pathways

    • Analyze regulation of genes in Salmonella pathogenicity islands (SPIs)

    • Compare with published stress response datasets

  • Network analysis:

    • Construct gene co-expression networks to identify modules associated with CrcB function

    • Infer potential regulatory relationships

    • Identify hub genes that might mediate CrcB's effects on broader networks

    • Integrate with protein-protein interaction data if available

  • Validation of key findings:

    • Confirm expression changes for selected genes using qRT-PCR

    • Test phenotypic predictions using targeted assays

    • Create additional mutants of identified network components to test predicted relationships

This approach would position CrcB within the broader stress response network of S. enteritidis PT4 and provide insights into how this protein contributes to bacterial adaptation to environmental challenges.

What are the most promising future research directions for S. enteritidis PT4 CrcB studies?

The most promising future research directions for S. enteritidis PT4 CrcB studies span multiple levels of biological investigation:

  • Structural and functional characterization:

    • Determine the high-resolution structure of CrcB using cryo-electron microscopy or X-ray crystallography

    • Characterize the fluoride transport mechanism through electrophysiological studies

    • Identify critical residues through systematic mutagenesis

    • Investigate potential secondary functions beyond fluoride transport

  • Genomic and evolutionary perspectives:

    • Analyze crcB sequence variation across the five major S. enterica lineages identified through population structure analysis

    • Investigate how recombination has influenced crcB evolution, given the varying recombination rates across lineages (r/m ranging from 0.15 to 2.95)

    • Determine how crcB has evolved in S. enteritidis PT4 compared to the closely related S. Gallinarum 287/91

  • Systems biology approaches:

    • Map the CrcB interactome to identify protein-protein interactions

    • Characterize the transcriptional response to crcB deletion under various conditions

    • Develop mathematical models integrating CrcB function with broader cellular physiology

    • Apply multi-omics approaches to understand CrcB's role in cellular networks

  • Pathogenesis and host interaction studies:

    • Investigate potential roles in virulence using methods similar to those applied for the hcp gene

    • Examine impacts on colonization and persistence in animal models

    • Study potential interactions with host factors during infection

    • Assess contributions to stress resistance in host environments

  • Translational applications:

    • Explore CrcB as a potential drug target, similar to approaches used for other Salmonella targets

    • Develop diagnostic applications based on crcB sequence or expression

    • Investigate potential for attenuated vaccine development

    • Consider biotechnological applications for fluoride bioremediation

These research directions would significantly advance our understanding of CrcB function in S. enteritidis PT4 and potentially lead to practical applications in disease control and biotechnology.

How might interdisciplinary approaches enhance our understanding of CrcB function?

Interdisciplinary approaches combining multiple scientific disciplines would significantly enhance our understanding of CrcB function in S. enteritidis PT4:

  • Integration of structural biology with computational approaches:

    • Combine experimental structure determination with molecular dynamics simulations

    • Apply quantum mechanics calculations to understand ion selectivity mechanisms

    • Use machine learning to predict functional impacts of sequence variations

    • Develop structural models informing drug design efforts

  • Merging evolutionary biology with functional genomics:

    • Analyze crcB evolution within the context of S. enterica population structure

    • Apply experimental evolution under fluoride stress to observe real-time adaptation

    • Use ancestral sequence reconstruction to test hypotheses about functional evolution

    • Correlate natural sequence variations with functional differences

  • Combining microbiology with systems biology:

    • Integrate transcriptomic, proteomic, and metabolomic data to build comprehensive models

    • Apply network theory to understand CrcB's position in cellular pathways

    • Develop mathematical models predicting bacterial behavior under various conditions

    • Use synthetic biology approaches to test model predictions

  • Uniting host-pathogen interaction studies with immunology:

    • Investigate how CrcB affects host immune recognition

    • Study potential contributions to immune evasion strategies

    • Examine interaction with host ion transport mechanisms

    • Consider impacts on microbiome composition during infection

  • Bridging basic science with translational research:

    • Apply knowledge of CrcB function to develop novel antimicrobials

    • Consider diagnostic applications based on crcB sequence or expression

    • Explore biotechnological applications in environmental remediation

    • Develop strategies for controlling Salmonella in agricultural settings

This interdisciplinary approach reflects modern scientific practice where complex biological questions require integration of diverse expertise and methodologies, as demonstrated by the comprehensive genomic and evolutionary studies of S. enterica that have combined bioinformatics, population genetics, and microbiology .

What are the optimal protocols for generating and validating crcB mutants in S. enteritidis PT4?

Generating and validating crcB mutants in S. enteritidis PT4 requires rigorous methodology to ensure specificity and reliability:

  • Mutant construction approaches:

    Option A: Lambda Red Recombination (preferred method)

    • Design primers with 40 bp homology to crcB flanking regions and 20 bp homology to antibiotic resistance cassette

    • Amplify resistance cassette (e.g., kanamycin or chloramphenicol) with flanking FRT sites

    • Transform PCR product into S. enteritidis PT4 expressing Lambda Red recombinase

    • Select recombinants on appropriate antibiotics

    • Use FLP recombinase to remove resistance marker if scarless mutation is desired

    Option B: CRISPR-Cas9 approach

    • Design gRNAs targeting crcB gene

    • Create repair template with desired modifications

    • Co-transform gRNA plasmid, Cas9 plasmid, and repair template

    • Screen transformants for successful editing

  • Verification methods:

    • PCR verification with primers flanking the modified region, similar to the approach used for the hcp mutant verification

    • Sequencing of the modified region to confirm precise alterations

    • Quantitative RT-PCR to confirm absence of crcB transcript

    • Western blotting if antibodies are available

    • Whole genome sequencing to rule out secondary mutations

  • Functional validation:

    • Growth curve analysis in standard media and under fluoride stress

    • Fluoride sensitivity assays using various concentrations

    • Direct measurement of fluoride transport using fluoride-specific electrodes

    • Complementation with wild-type crcB to restore function

  • Controls and standards:

    • Include wild-type S. enteritidis PT4 in all experiments

    • Generate complementation strains expressing crcB from plasmids

    • Create point mutants affecting key residues as additional controls

    • Use appropriate statistical analysis for all quantitative measurements

This systematic approach ensures that phenotypes attributed to crcB mutation are specific and not due to polar effects or secondary mutations, providing a solid foundation for further functional studies.

What are the key considerations for designing experiments to study CrcB-mediated fluoride resistance?

Designing robust experiments to study CrcB-mediated fluoride resistance in S. enteritidis PT4 requires careful attention to several methodological considerations:

  • Strain construction and validation:

    • Generate multiple independent crcB mutants to rule out clone-specific effects

    • Create complementation strains expressing wild-type crcB from different promoters

    • Develop strains with tagged versions of CrcB for localization and interaction studies

    • Verify all strains genetically and phenotypically before use

  • Growth and viability assays:

    • Design dose-response experiments with precisely defined fluoride concentrations

    • Control media composition carefully, as calcium and other ions affect fluoride toxicity

    • Monitor growth over extended time periods to capture adaptation responses

    • Use multiple methods to assess viability (plate counts, metabolic indicators, live/dead staining)

  • Fluoride transport measurements:

    • Develop protocols using fluoride-selective electrodes for real-time measurements

    • Establish standardized conditions for cell preparation and buffer composition

    • Include appropriate controls for non-specific binding and background signals

    • Consider isotope-based methods for highest sensitivity

  • Gene expression analysis:

    • Design time-course experiments to capture dynamic responses to fluoride

    • Use appropriate reference genes validated for stability under experimental conditions

    • Apply multiple methods (RT-qPCR, RNA-seq, reporter fusions) for robust results

    • Include controls for general stress responses to distinguish specific effects

  • Data analysis and statistical considerations:

    • Design experiments with sufficient biological and technical replicates

    • Apply appropriate statistical tests with corrections for multiple comparisons

    • Use blinding procedures where applicable to prevent bias

    • Establish clear criteria for data inclusion/exclusion before experiments begin

  • Environmental variables to control:

    • Temperature and pH must be precisely controlled as they affect fluoride speciation

    • Growth phase standardization is critical as resistance may vary

    • Oxygen availability can impact stress responses and should be monitored

    • Media batch variation should be minimized through quality control

These methodological considerations ensure that experiments investigating CrcB-mediated fluoride resistance produce reliable, reproducible results that accurately reflect the biological role of this protein in S. enteritidis PT4.

What specialized techniques are available for studying membrane proteins like CrcB?

Studying membrane proteins like CrcB requires specialized techniques that address the challenges of their hydrophobic nature and lipid environment requirements:

  • Protein expression and purification approaches:

    • Cell-free expression systems designed for membrane proteins

    • Use of specialized E. coli strains (C41/C43, Lemo21) with modified membrane capacity

    • Detergent screening to identify optimal solubilization conditions

    • Lipid nanodiscs or amphipols as alternatives to detergents for maintaining native structure

    • On-column detergent exchange during purification

  • Structural characterization methods:

    • Cryo-electron microscopy, particularly suitable for membrane proteins without size limitations

    • X-ray crystallography using lipidic cubic phase for membrane protein crystals

    • Solid-state NMR specifically developed for membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and topology

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Functional analysis techniques:

    • Electrophysiology methods (patch-clamp, planar lipid bilayers) for direct channel measurements

    • Fluorescent probes for measuring ion flux in proteoliposomes

    • Solid-supported membrane electrophysiology for automated screening

    • Surface plasmon resonance for interaction studies in membrane-mimetic environments

    • Microscale thermophoresis for binding studies in detergent solutions

  • Localization and topology mapping:

    • Fluorescent protein fusions with careful design to minimize functional disruption

    • Substituted cysteine accessibility method (SCAM) for topology mapping

    • Super-resolution microscopy for precise localization

    • Protease protection assays to determine membrane orientation

    • Site-specific chemical labeling approaches

  • Computational methods specifically for membrane proteins:

    • Specialized algorithms for transmembrane domain prediction

    • Molecular dynamics simulations in explicit lipid bilayers

    • Coarse-grained simulations for larger scale membrane processes

    • Membrane protein-specific docking tools for interaction studies

These specialized techniques overcome the challenges inherent in membrane protein research and would enable comprehensive characterization of CrcB structure, function, and interactions in S. enteritidis PT4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.