Recombinant Salmonella enteritidis PT4 Rhomboid protease glpG (glpG)

What is Rhomboid Protease GlpG in Salmonella enteritidis PT4 and what is its genetic context?

Rhomboid protease GlpG in Salmonella enteritidis PT4 is an intramembrane serine protease that belongs to the widely conserved rhomboid family of proteases. In the Salmonella enteritidis PT4 578 genome, which consists of 4,685,705 bp with 4,506 predicted coding sequences, the glpG gene encodes a 276-amino acid protein . The protein is part of the membrane protein complement that contributes to various cellular processes. The amino acid sequence begins with MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELA and continues for the full 276 residues . Unlike many virulence factors that are encoded within Salmonella Pathogenicity Islands (SPIs), glpG is part of the core genome and plays roles in both pathogenic and non-pathogenic processes.

How does the structure of Salmonella enteritidis PT4 GlpG compare to other bacterial rhomboid proteases?

The structure of Salmonella enteritidis PT4 GlpG shares the canonical rhomboid protease fold with six transmembrane domains and a catalytic dyad consisting of serine and histidine residues. Comparative genomic analysis between Salmonella Enteritidis PT4 578 and other Salmonella strains shows high conservation of membrane proteins like GlpG . While specific crystal structures for the Salmonella enteritidis PT4 GlpG have not been reported in the provided search results, the protein is predicted to have structural similarity to the well-characterized E. coli GlpG rhomboid protease, with which it shares significant sequence homology. The availability of recombinant full-length protein (1-276 amino acids) with an N-terminal His-tag allows for structural studies using techniques such as X-ray crystallography or cryo-electron microscopy .

What experimental methods are recommended for initial characterization of recombinant GlpG protein activity?

For initial characterization of recombinant Salmonella enteritidis PT4 GlpG activity, researchers should employ a multi-faceted approach:

• Protease Activity Assays: Using fluorogenic peptide substrates containing the recognition sequence for rhomboid proteases to measure enzymatic activity

• Detergent Optimization: Testing various detergents (DDM, LMNG, digitonin) at different concentrations to maintain protein stability and activity after purification

• Substrate Identification: Employing techniques such as TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify physiological substrates

• Inhibitor Profiling: Testing sensitivity to known rhomboid protease inhibitors (e.g., DCI, isocoumarin derivatives)

The recombinant full-length His-tagged protein expressed in E. coli provides a valuable tool for these characterization studies . When designing activity assays, researchers should consider the membrane-embedded nature of the protein and ensure proper reconstitution in artificial membrane systems or detergent micelles to maintain the native conformation and activity.

What are the optimal conditions for expressing recombinant Salmonella enteritidis PT4 GlpG in E. coli?

The optimal conditions for expressing recombinant Salmonella enteritidis PT4 GlpG in E. coli involve several critical parameters:

The recombinant GlpG protein requires careful handling due to its membrane-embedded nature. The commercial preparation is provided as a lyophilized powder, suggesting that proper refolding conditions are critical for maintaining protein activity . Expression in E. coli has been successfully demonstrated, as evidenced by the availability of the full-length protein (1-276 amino acids) with an N-terminal His-tag . Researchers should monitor expression levels using Western blotting with anti-His antibodies and optimize conditions based on protein yield and solubility.

What purification strategies yield the highest purity and activity for recombinant GlpG?

A multi-step purification strategy is recommended to obtain high-purity, active recombinant Salmonella enteritidis PT4 GlpG:

• Membrane Preparation: After cell lysis, isolate membrane fractions through differential centrifugation

• Detergent Solubilization: Extract GlpG using mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol)

• IMAC Purification: Utilize immobilized metal affinity chromatography with Ni-NTA resin, incorporating detergent in all buffers

• Size Exclusion Chromatography: Further purify using gel filtration to remove aggregates and ensure homogeneity

• Quality Control: Assess purity by SDS-PAGE and activity using fluorogenic substrate assays

The commercially available recombinant protein is produced with an N-terminal His-tag that facilitates initial capture using IMAC . When choosing purification conditions, researchers should be mindful that rhomboid proteases require proper detergent environments to maintain their native fold and catalytic activity. Typically, final preparations with >95% purity can be achieved using this approach, yielding 1-5 mg of purified protein per liter of bacterial culture.

How can researchers reconstitute lyophilized recombinant GlpG to ensure proper folding and activity?

Proper reconstitution of lyophilized recombinant Salmonella enteritidis PT4 GlpG is crucial for maintaining its structural integrity and enzymatic activity:

• Initial Resuspension: Gently dissolve the lyophilized powder in a buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, and 10% glycerol

• Detergent Addition: Incorporate a suitable detergent (0.1% DDM or 0.05% LMNG) to maintain membrane protein solubility

• Gradual Dilution: Perform stepwise dilution while monitoring for precipitation

• Incubation Period: Allow 1-2 hours at 4°C with gentle rotation for complete reconstitution

• Centrifugation: Remove any insoluble material by centrifugation at 20,000 × g for 15 minutes

• Activity Verification: Confirm functional reconstitution using a fluorogenic peptide substrate assay

For long-term storage, researchers should avoid repeated freeze-thaw cycles, instead preparing small aliquots for single use. When working with the reconstituted protein, maintaining a stable detergent concentration above the critical micelle concentration is essential to prevent aggregation and loss of activity. Alternative reconstitution into lipid nanodiscs or proteoliposomes may be considered for specific functional studies requiring a lipid bilayer environment.

What are the known physiological substrates of Salmonella enteritidis PT4 GlpG and how can novel substrates be identified?

• Cell envelope proteins: Particularly those involved in membrane integrity and remodeling

• Secreted effector proteins: Potentially including virulence factors that require proteolytic processing

• Quorum sensing mediators: Proteins involved in bacterial communication systems

For novel substrate identification, researchers should employ:

• Proteomics approaches: Comparative analysis of proteomes from wild-type vs. glpG deletion mutants

• TAILS (Terminal Amine Isotopic Labeling of Substrates): For systematic identification of proteolytic events

• Bacterial two-hybrid screening: To identify protein-protein interactions involving GlpG

• In vitro cleavage assays: Using recombinant GlpG and candidate substrate proteins

While the genome analysis of Salmonella Enteritidis PT4 578 identified 165 genes (3.66% of the genome) encoding virulence factors associated with cell invasion, intestinal colonization, and intracellular survival , the specific role of GlpG in processing these factors requires further investigation through the methodologies outlined above.

How does GlpG contribute to Salmonella enteritidis PT4 virulence and pathogenicity?

The contribution of GlpG to Salmonella enteritidis PT4 virulence and pathogenicity involves multiple potential mechanisms:

• Membrane Protein Processing: GlpG likely processes specific membrane proteins required for host-pathogen interactions. Salmonella Enteritidis PT4 578 contains 12 Salmonella pathogenicity islands (SPIs) that harbor numerous virulence factors , and GlpG may regulate the activity of proteins encoded within these regions.

• Stress Response Modulation: Rhomboid proteases often function in bacterial stress responses, which are critical during infection. The Salmonella Enteritidis PT4 578 genome contains genes related to stress and anaerobic adaptation that may be regulated by GlpG .

• Biofilm Formation: Salmonella Enteritidis PT4 578 shows distinctive phenotypic characteristics regarding biofilm formation , and GlpG may influence this process through proteolytic regulation of membrane proteins involved in attachment and community development.

• Fimbrial Protein Processing: The genome contains thirteen clusters of fimbriae (csg, bcf, fim, lpf, saf, sef, stb, std, ste, stf, sth, sti, and peg) , and GlpG could potentially process components of these adhesive structures.

To definitively establish GlpG's role in virulence, researchers should perform comparative virulence studies using isogenic wild-type and glpG mutant strains in appropriate infection models, coupled with transcriptomic and proteomic analyses to identify affected pathways.

What methodological approaches can be used to study GlpG inhibition for potential therapeutic applications?

To investigate GlpG inhibition for potential therapeutic applications, researchers should employ a systematic approach:

• High-throughput Screening: Development of fluorescence-based assays using the recombinant protein to screen chemical libraries for inhibitory compounds

• Structure-guided Design: Utilizing homology models based on related rhomboid proteases to design targeted inhibitors

• Fragment-based Drug Discovery: Identifying small molecular fragments that bind to GlpG and can be developed into larger inhibitors

• In silico Screening: Computational docking of virtual compound libraries against the GlpG active site

• Validation Cascade:

  • Biochemical confirmation of hits using purified recombinant GlpG

  • Cellular assays in Salmonella cultures

  • Efficacy testing in infection models

  • Selectivity profiling against human rhomboid proteases

Given that Salmonella Enteritidis causes self-limited gastroenteritis in humans, which can progress to systemic infection in immunocompromised individuals , developing specific GlpG inhibitors may represent a novel therapeutic strategy, particularly for antibiotic-resistant strains.

How do mutations in the catalytic site of GlpG impact substrate specificity and enzyme kinetics?

Mutations in the catalytic site of Salmonella enteritidis PT4 GlpG can have profound effects on substrate specificity and enzyme kinetics. The catalytic machinery of rhomboid proteases typically involves a serine-histidine dyad:

• Catalytic Serine Mutations (S201A): Complete abolishment of proteolytic activity while maintaining substrate binding capability. This mutation is valuable for co-crystallization studies with substrates.

• Catalytic Histidine Mutations (H254A): Severely reduced catalytic efficiency (kcat/KM) with minimal residual activity. This mutation often affects the hydrogen-bonding network essential for catalysis.

• Loop 5 Modifications: Alterations to the dynamic loop 5 region that caps the active site can modulate substrate recognition profiles, potentially broadening or narrowing substrate specificity.

• Transmembrane Domain Mutations: Changes to residues lining the substrate binding pocket can shift preference between different transmembrane substrates.

An experimental approach to investigate these effects would involve:

• Site-directed mutagenesis of the recombinant Salmonella enteritidis PT4 glpG gene

• Expression and purification of mutant proteins using established protocols

• Comparative enzyme kinetics using a panel of fluorogenic peptide substrates

• Structural analysis of wild-type and mutant proteins to correlate functional changes with structural alterations

Researchers should note that the full-length recombinant protein (276 amino acids) with an N-terminal His-tag provides an excellent starting point for generating these mutants and performing comprehensive structure-function analyses.

What are the differences in rhomboid protease activity between Salmonella enteritidis PT4 and other Salmonella serotypes?

Comparative analysis of rhomboid protease activity between Salmonella enteritidis PT4 and other Salmonella serotypes reveals both conserved and distinctive features:

• Sequence Conservation: Genome analysis of Salmonella Enteritidis PT4 578 compared with Salmonella Enteritidis ATCC 13076, Salmonella Typhimurium ATCC 13311, and Salmonella Typhimurium ATCC 14028 shows that most unshared genes are related to metabolism, membrane, and hypothetical proteins . This suggests potential differences in membrane protein processing patterns among serotypes.

• Substrate Profiles: Different Salmonella serotypes likely exhibit variations in the specificity and efficiency of substrate processing by their respective GlpG proteases, reflecting adaptations to their particular ecological niches and host ranges.

• Expression Patterns: Regulatory differences in glpG expression may exist between serotypes, potentially contributing to their distinctive virulence characteristics and host adaptation strategies.

• Functional Redundancy: The presence and activity of other proteases may compensate for or complement GlpG function differently across serotypes.

To experimentally investigate these differences, researchers should:

• Perform comparative biochemical characterization of recombinant GlpG proteins from multiple serotypes

• Develop serotype-specific proteomics approaches to identify the unique substrate profiles

• Create cross-complementation experiments by expressing GlpG from one serotype in another

• Correlate differences in GlpG activity with the distinctive phenotypic characteristics observed among serotypes, such as the red, dry, and rough (rdar) morphotype and biofilm formation capabilities

How does the membrane environment affect GlpG activity and what lipid compositions optimize function?

The membrane environment significantly influences GlpG activity through multiple mechanisms, and optimizing lipid compositions is crucial for maintaining function:

• Lipid-Protein Interactions: Specific phospholipids may directly interact with GlpG, affecting its conformation and catalytic activity. The hydrophobic transmembrane domains of GlpG are particularly sensitive to the surrounding lipid environment.

• Membrane Thickness Effects: The hydrophobic mismatch between GlpG's transmembrane domains and the lipid bilayer thickness can alter protein conformation and activity. Experimental approaches should test lipid bilayers of varying thicknesses.

• Charge Distribution: The distribution of charged lipids affects the electrostatic environment around GlpG, potentially influencing substrate recruitment and processing.

• Lateral Pressure Profile: Different lipid compositions create varying lateral pressure profiles within the membrane, which can affect the conformational dynamics of GlpG.

Optimal experimental approaches include:

Researchers working with the recombinant Salmonella enteritidis PT4 GlpG should systematically investigate these parameters to establish optimal conditions for functional studies and to understand how membrane composition might regulate GlpG activity in the native bacterial context.

What are common pitfalls in working with recombinant GlpG and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Salmonella enteritidis PT4 GlpG:

• Protein Aggregation: The hydrophobic nature of GlpG makes it prone to aggregation. To address this:

  • Use freshly prepared samples whenever possible

  • Maintain detergent concentrations above CMC throughout all procedures

  • Consider adding glycerol (10-15%) to stabilize the protein

  • Monitor protein state using dynamic light scattering before experiments

• Low Enzymatic Activity: Recombinant GlpG often shows reduced activity compared to native protein. Solutions include:

  • Optimize reconstitution conditions for the lyophilized protein

  • Test multiple detergent and lipid environments

  • Ensure complete removal of potential inhibitors from purification steps

  • Validate protein folding using circular dichroism spectroscopy

• Substrate Accessibility Issues: The transmembrane nature of substrates complicates activity assays. Recommendations:

  • Design substrates with optimal positioning of cleavage sites

  • Ensure proper substrate incorporation into the same micelles as GlpG

  • Consider using detergent-solubilized microsomal preparations for more native-like conditions

• Storage Stability: GlpG activity decreases during storage. Best practices:

  • Store the lyophilized powder at -80°C

  • For reconstituted protein, prepare small single-use aliquots

  • Avoid repeated freeze-thaw cycles

  • Include protease inhibitors (except serine protease inhibitors) to prevent degradation

• Inconsistent Results Between Batches: Establish rigorous quality control measures:

  • Standardize expression and purification protocols

  • Characterize each batch by SDS-PAGE, Western blot, and activity assays

  • Use internal standards for activity normalization between experiments

How can researchers develop reliable quantitative assays for measuring GlpG activity in complex biological samples?

Developing reliable quantitative assays for measuring GlpG activity in complex biological samples requires addressing several technical challenges:

• Design of Specific Substrates:

  • Synthesize fluorogenic peptides incorporating known rhomboid recognition motifs

  • Include transmembrane segments that mimic natural substrates

  • Add reporter groups (FRET pairs, fluorophore-quencher combinations) that produce measurable signals upon cleavage

• Extraction and Sample Preparation:

  • Optimize gentle membrane protein extraction techniques that preserve native GlpG activity

  • Develop differential centrifugation protocols to isolate membrane fractions

  • Use detergent solubilization conditions that maintain enzyme activity

• Activity Discrimination:

  • Include specific inhibitors of other proteases present in the sample

  • Design control experiments with known GlpG inhibitors to establish specificity

  • Use GlpG-knockout samples as negative controls

• Quantification Strategies:

  • Develop standard curves using purified recombinant GlpG

  • Implement internal calibration standards to normalize between experiments

  • Use kinetic measurements rather than endpoint assays for greater accuracy

• Validation in Complex Systems:

  • Confirm activity measurements using orthogonal methods (Western blotting, mass spectrometry)

  • Test assay performance in increasingly complex samples (purified membranes → cell lysates → intact cells)

  • Establish limits of detection and quantification appropriate for the biological context

When applying these assays to Salmonella enteritidis PT4, researchers should consider the genomic context of GlpG and potential interactions with other components of the bacterial membrane and virulence systems .

What cutting-edge technologies are advancing our understanding of rhomboid proteases like GlpG?

Several cutting-edge technologies are significantly advancing our understanding of rhomboid proteases like Salmonella enteritidis PT4 GlpG:

• Cryo-Electron Microscopy (Cryo-EM):

  • Enables visualization of rhomboid proteases in native-like lipid environments

  • Captures different conformational states during the catalytic cycle

  • Provides insights into substrate binding and processing mechanisms

  • Can be applied to the recombinant full-length Salmonella enteritidis PT4 GlpG

• Native Mass Spectrometry:

  • Analyzes intact membrane protein complexes with bound lipids and detergents

  • Identifies specific lipid interactions that modulate GlpG activity

  • Characterizes protein-substrate complexes in their native state

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Maps conformational dynamics and flexible regions of GlpG

  • Identifies substrate-induced conformational changes

  • Tracks allosteric communication networks within the protein

• Single-Molecule Fluorescence Techniques:

  • Observes individual catalytic events in real-time

  • Characterizes conformational heterogeneity of GlpG populations

  • Correlates structural dynamics with enzymatic function

• Artificial Intelligence and Computational Approaches:

  • Predicts substrate specificity based on protein sequence and structure

  • Models membrane-protein interactions with atomic precision

  • Designs novel inhibitors targeting specific features of GlpG

• Genome-Wide Association Studies and Comparative Genomics:

  • The whole-genome sequencing of Salmonella Enteritidis PT4 578 provides a foundation for comparative analysis

  • Identifies natural variations in glpG across bacterial strains and their correlation with phenotypic differences

  • Reveals evolutionary patterns that inform functional significance

• CRISPR-Cas9 Genome Editing:

  • Creates precise mutations in the bacterial genome to study GlpG function

  • Enables high-throughput functional genomics screens

  • Generates innovative reporter systems for monitoring GlpG activity in vivo

These technologies, when applied to the study of recombinant Salmonella enteritidis PT4 GlpG , will provide unprecedented insights into its structure, function, and role in bacterial physiology and pathogenesis.

What are the most promising research directions for understanding GlpG's role in Salmonella pathogenesis?

The most promising research directions for understanding GlpG's role in Salmonella pathogenesis include:

• Substrate Identification and Characterization: Comprehensive identification of physiological GlpG substrates using proteomics approaches will reveal its functional impact on Salmonella enteritidis PT4 virulence networks. The availability of recombinant protein enables validation of putative substrates through in vitro assays.

• Systems Biology Approaches: Integration of transcriptomics, proteomics, and metabolomics data from wild-type and glpG mutant strains during infection to map the regulatory networks influenced by GlpG activity.

• Host-Pathogen Interaction Studies: Investigation of how GlpG activity modulates Salmonella interactions with host cells, particularly in the context of the 165 virulence genes identified in the Salmonella Enteritidis PT4 578 genome .

• Biofilm Regulation: Exploration of GlpG's role in the distinctive biofilm formation characteristics observed in Salmonella Enteritidis PT4 578 , potentially through proteolytic processing of adhesins or matrix components.

• Comparative Virulence Studies: Analysis of how variations in GlpG sequence, expression, and activity correlate with the different virulence profiles observed across Salmonella serotypes.

• Structural Biology: Determination of Salmonella enteritidis PT4 GlpG structure using the recombinant protein to identify unique features that could be targeted for antimicrobial development.

• In vivo Infection Models: Development of animal models to assess the impact of GlpG activity on colonization, persistence, and systemic spread of Salmonella enteritidis PT4.

These research directions will significantly advance our understanding of how this intramembrane protease contributes to the complex pathogenicity mechanisms of Salmonella enteritidis PT4.

How might GlpG inhibitors be developed as potential therapeutic agents against Salmonella infections?

The development of GlpG inhibitors as potential therapeutic agents against Salmonella infections involves a multidisciplinary approach:

• Target Validation: Establish the essentiality of GlpG for Salmonella virulence through genetic knockout studies and in vivo infection models. The genomic characterization of Salmonella Enteritidis PT4 578 provides context for understanding GlpG's role within the pathogen's virulence network.

• High-Throughput Screening: Utilize the available recombinant Salmonella enteritidis PT4 GlpG protein in biochemical assays to screen compound libraries for inhibitory activity.

• Structure-Based Drug Design: Apply rational design approaches based on:

  • Homology models of Salmonella GlpG

  • Co-crystal structures with initial hit compounds

  • Molecular dynamics simulations of enzyme-inhibitor interactions

• Medicinal Chemistry Optimization: Iterative improvement of lead compounds focusing on:

  • Potency against purified recombinant GlpG

  • Selectivity over human rhomboid proteases

  • Physiochemical properties for membrane penetration

  • Pharmacokinetic and safety profiles

• Therapeutic Efficacy Studies:

  • Evaluation in cellular infection models

  • Assessment in animal models of Salmonella infection

  • Combination studies with existing antibiotics

• Resistance Development Assessment: Investigate the potential for resistance development through:

  • Serial passage experiments

  • Whole genome sequencing of resistant isolates

  • Structural analysis of resistance-conferring mutations

• Delivery System Development: Design specialized delivery systems to enhance inhibitor access to intracellular Salmonella, particularly relevant given Salmonella's ability to cause systemic infections in immunocompromised individuals .

The development pipeline should prioritize inhibitors that target unique features of bacterial rhomboid proteases to minimize off-target effects on human homologs.

What interdisciplinary approaches would advance our understanding of GlpG function in bacterial physiology and pathogenesis?

Advancing our understanding of GlpG function in bacterial physiology and pathogenesis requires innovative interdisciplinary approaches:

• Integrative Structural Biology: Combining crystallography, cryo-EM, NMR, and computational modeling to characterize the full conformational landscape of GlpG using the recombinant protein . This would reveal how structural dynamics correlate with catalytic function and substrate recognition.

• Systems Microbiology: Applying network analysis to multi-omics data to position GlpG within the complex regulatory networks of Salmonella enteritidis PT4. This approach would leverage the comprehensive genomic characterization already available to contextualize GlpG function.

• Synthetic Biology: Engineering reporter systems and orthogonal rhomboid-substrate pairs to monitor GlpG activity in real-time during infection, providing insights into the spatial and temporal regulation of its function.

• Advanced Imaging Technologies: Developing super-resolution microscopy approaches to visualize GlpG localization and dynamics within bacterial membranes during different phases of the infection cycle.

• Host-Pathogen Interface Analysis: Investigating how GlpG-mediated proteolytic events influence host immune recognition and response to Salmonella infection.

• Evolutionary Bioinformatics: Conducting comprehensive comparative genomics across Salmonella serotypes to understand how variations in GlpG sequence and expression correlate with host adaptation and virulence potential.

• Microbiome Ecology: Exploring how GlpG activity affects Salmonella interactions with the gut microbiome, potentially influencing colonization resistance and persistence.

• Machine Learning Approaches: Developing predictive models for substrate recognition and cleavage efficiency based on combined sequence, structural, and functional data.