Recombinant Salmonella enteritidis PT4 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella enteritidis PT4 Spermidine Export Protein MdtI (mdtI)

Recombinant Salmonella enteritidis PT4 Spermidine export protein MdtI (mdtI) is a bioengineered protein derived from Salmonella enteritidis serovar Enteritidis PT4, a pathogenic bacterium commonly linked to foodborne illnesses. This protein belongs to the small multidrug resistance (SMR) family and functions as part of a spermidine export complex, critical for maintaining cellular polyamine homeostasis. MdtI is expressed as a recombinant product in E. coli systems, typically with a histidine (His) tag for purification and structural stability .

Amino Acid Sequence and Gene Information

AttributeDetail
Gene NamemdtI (SEN1566)
Uniprot IDB5QUE3
Protein LengthFull-length (1-109 amino acids)
AA SequenceMQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
TagN-terminal His-tag
Purity>90% (SDS-PAGE)

Critical Residues:

  • MdtI: Glu5, Glu19, Asp60, Trp68, Trp81 (involved in substrate binding and transport) .

Use in Biomedical Research

  • Vaccine Development: Recombinant MdtI could serve as an antigen in subunit vaccines targeting Salmonella Enteritidis .

  • Pathogenicity Studies: Investigating MdtI’s role in stress response and host colonization .

Comparative Analysis: MdtI vs. MdtJ

FeatureMdtI (mdtI)MdtJ (mdtJ)
Uniprot IDB5QUE3B5QUE4
AA SequenceMQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFAMFYWILLALAIATEITGTLSMKWASVGNGNAGFILmLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Gene LocusSEN1566SEN1567
TagHis-tagUndetermined (depends on production) .

Functional Insights

  • Spermidine Toxicity Rescue: In E. coli, MdtJI expression rescues viability under high spermidine concentrations by reducing intracellular levels .

  • Genome Context: In Salmonella Enteritidis PT4, mdtI is not part of pathogenicity islands (SPIs) but is conserved in non-typhoidal Salmonella .

Limitations

  • Species-Specific Data: Most functional studies focus on E. coli MdtJI; direct evidence for Salmonella MdtI is limited .

  • Protein Stability: Lyophilized MdtI requires careful handling to prevent aggregation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mdtI; SEN1566; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links

KEGG: set:SEN1566

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant production of mdtI?

While various expression systems can be employed, E. coli remains the predominant host for recombinant mdtI production . When selecting an expression system, researchers should consider:

Methodology:

  • The primary expression system utilized is E. coli, which offers robust protein yields and established protocols

  • The gene encoding mdtI is typically cloned into expression vectors containing:

    • An inducible promoter (e.g., T7 or lac promoter)

    • A His-tag sequence for purification

    • Appropriate antibiotic resistance markers for selection

  • Transformation is performed using standard protocols in competent E. coli cells

  • Expression is induced using IPTG or autoinduction methods

Based on comparable Salmonella protein expression studies, the E. coli strain C41 might offer superior yields compared to other strains such as Rosetta, Turner, C43, Origami, BL21pLys, or Rosetta pLys .

How can researchers optimize purification of recombinant mdtI?

Purification of recombinant mdtI requires careful consideration of its membrane-associated properties. The following methodology has proven effective:

  • Cell Lysis Protocol:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in lysis buffer containing:

      • 50 mM Tris-HCl, pH 8.0

      • 300 mM NaCl

      • 10 mM imidazole

      • Protease inhibitor cocktail

    • Lyse cells using sonication or mechanical disruption

  • Membrane Protein Extraction:

    • Centrifuge lysate (20,000 × g, 30 min, 4°C) to pellet inclusion bodies and cell debris

    • Isolate membrane fraction through ultracentrifugation (100,000 × g, 1 hr, 4°C)

    • Solubilize membrane proteins using a detergent-based buffer (e.g., 1-2% n-dodecyl-β-D-maltoside)

  • Affinity Chromatography:

    • Apply solubilized protein to Ni-NTA resin

    • Wash with buffer containing 20-40 mM imidazole

    • Elute purified protein using an imidazole gradient (50-300 mM)

  • Further Purification Steps:

    • Size exclusion chromatography to separate monomers from aggregates

    • Ion exchange chromatography for removal of contaminants

For lyophilized recombinant mdtI protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What are the established protocols for functional characterization of mdtI?

Functional characterization of mdtI as a spermidine export protein requires specialized methodologies:

Spermidine Transport Assays:

  • In vivo assays:

    • Generate mdtI knockout and mdtI-overexpressing strains

    • Expose bacterial cells to radiolabeled spermidine (³H-spermidine)

    • Measure intracellular vs. extracellular spermidine levels over time

    • Compare transport rates between wild-type, knockout, and overexpression strains

  • Proteoliposome reconstitution:

    • Incorporate purified mdtI into liposomes

    • Establish spermidine gradient across liposomal membrane

    • Measure spermidine transport using fluorescent spermidine analogs or radiolabeled spermidine

    • Assess effects of inhibitors and membrane potential on transport activity

Electrophysiological Characterization:

  • Patch-clamp analysis of mdtI-containing proteoliposomes or bacterial spheroplasts

  • Black lipid membrane (BLM) conductance measurements with reconstituted mdtI

For comprehensive functional analysis, researchers should employ multiple complementary approaches to validate transport activity and specificity.

What genomic and expression analysis methods are recommended for studying mdtI in different Salmonella strains?

To investigate mdtI expression and genomic contexts across Salmonella strains, researchers should employ:

Genomic Analysis:

  • Whole Genome Sequencing:

    • Illumina short-read sequencing (coverage >100×) for accurate SNP detection

    • PacBio or Oxford Nanopore long-read sequencing for complete genome assembly

    • Hybrid assembly approaches for optimal resolution

  • Comparative Genomics:

    • Analyze genomic context of mdtI using tools like SISTR for Salmonella isolates

    • Identify sequence variations in mdtI across serovars

    • Determine if mdtI is located on genomic islands or mobile genetic elements

Expression Analysis:

  • Transcriptomics:

    • RNA-Seq under various growth and stress conditions

    • qRT-PCR for targeted expression analysis

    • Promoter-reporter fusions to study regulation

  • Proteomics:

    • MS/MS analysis of membrane fractions

    • Targeted proteomics using selected reaction monitoring (SRM)

    • Western blot analysis with anti-mdtI antibodies

Recent genomic studies indicate that mdtI may be part of conserved genomic regions in Salmonella Enteritidis isolates. Analysis of 341 Salmonella isolates revealed that the core genome accounts for approximately one-quarter of the pangenome, suggesting mdtI may be part of this conserved core .

How can researchers effectively integrate mdtI into recombinant attenuated Salmonella vaccine (RASV) development?

Integrating mdtI into RASV development requires careful consideration of:

Vector Construction:

  • Balanced-lethal vector-host systems to ensure plasmid stability without antibiotic selection

  • Regulated delayed synthesis systems for improved colonization and immune responses

  • Selection of appropriate promoters for controlled mdtI expression

Attenuation Strategies:

  • Regulated delayed attenuation to preserve vaccine strain viability during initial colonization

  • Consider mdtI expression timing relative to other vaccine antigens

  • Ensure appropriate mdtI expression without compromising strain safety

Delivery and Immunogenicity:

  • Oral delivery considerations: protection from gastric environment

  • Assessment of immune responses:

    • Antibody production (IgG, IgA)

    • T-cell responses

    • Protection in challenge models

The RASV approach has been successfully employed for delivering heterologous antigens, and these strategies could be adapted for mdtI if it represents a potential vaccine target .

What is the potential role of mdtI in antimicrobial resistance mechanisms?

While mdtI functions primarily as a spermidine export protein, its potential contributions to antimicrobial resistance warrant investigation:

Polyamine Transport and Resistance:

  • Polyamines like spermidine can modulate bacterial susceptibility to antibiotics by:

    • Altering membrane permeability

    • Neutralizing reactive oxygen species

    • Affecting biofilm formation

Methodological Approach:

  • Generate mdtI knockout and overexpression strains

  • Perform antimicrobial susceptibility testing using:

    • Broth microdilution method

    • Disk diffusion assays

    • Time-kill studies

  • Assess changes in minimum inhibitory concentrations (MICs) for different antibiotic classes

  • Investigate synergy between mdtI inhibition and conventional antibiotics

Recent genomic analyses have identified multiple antimicrobial resistance genes (ARGs) in Salmonella Enteritidis isolates, along with chromosomal point mutations in genes like gyrA and acrB . Understanding how mdtI interacts with these known resistance determinants could provide insights into novel therapeutic approaches.

How does mdtI compare with other membrane transport proteins in Salmonella enteritidis PT4?

Comparative analysis of mdtI with other Salmonella transport proteins reveals:

TransporterSize (aa)SubstrateFunctionGenomic Context
MdtI109SpermidinePolyamine exportOften co-expressed with mdtJ
IciAVariesN/AChromosome initiation inhibitorRegulatory regions
Hsp60~550N/AChaperone proteinHeat shock operon
AcrB~1000Multiple antibioticsMultidrug effluxacrAB-tolC operon

Methodological Approaches for Comparative Studies:

  • Structural comparison using homology modeling and crystallography

  • Functional characterization through complementation studies

  • Evolutionary analysis using phylogenetic methods

  • Expression correlation analysis under various stress conditions

Understanding the relationships between mdtI and other transport systems provides context for its evolutionary and functional significance in Salmonella biology.

What are the technical challenges in studying membrane proteins like mdtI and how can they be addressed?

Membrane proteins like mdtI present unique challenges that require specialized approaches:

Challenge 1: Protein Solubility and Stability

  • Solution: Screen multiple detergents (DDM, LDAO, FC-12) for optimal solubilization

  • Methodology: Systematic detergent screening with thermal stability assays

Challenge 2: Low Expression Yields

  • Solution: Optimize expression conditions through factorial design experiments

  • Methodology: Compare induction methods (IPTG vs. autoinduction), temperature, and host strains

Challenge 3: Functional Reconstitution

  • Solution: Develop robust proteoliposome systems with controlled lipid composition

  • Methodology: Systematic optimization of protein:lipid ratios and reconstitution protocols

Challenge 4: Structural Characterization

  • Solution: Combine complementary structural biology approaches

  • Methodology: Cryo-EM, X-ray crystallography, and NMR for different structural aspects

Comparative studies on recombinant Salmonella Enteritidis proteins indicate that autoinduction methods may yield significantly higher protein amounts (>800 μg/2L culture) compared to IPTG induction (400 μg/2L culture) , which may be applicable to mdtI production.

What bioinformatic approaches are recommended for analyzing the evolutionary conservation of mdtI across Salmonella serovars?

To analyze mdtI evolution and conservation, researchers should implement:

Sequence Analysis Pipeline:

  • Homolog Identification:

    • BLAST searches against diverse Salmonella genomes

    • HMM-based approaches for distant homolog detection

  • Multiple Sequence Alignment:

    • MUSCLE or MAFFT for alignment of mdtI sequences

    • Manual curation of alignments in problematic regions

  • Phylogenetic Analysis:

    • Maximum Likelihood methods (RAxML, IQ-TREE)

    • Bayesian inference (MrBayes)

    • Selection of appropriate evolutionary models using ModelTest

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify selection signatures

    • Site-specific selection tests using PAML or HyPhy

Visualization and Interpretation:

  • Phylogenetic trees with annotated metadata (serovar, host, geography)

  • Protein structure mapping of conserved vs. variable regions

Recent genomic studies have revealed that Salmonella serovars show distinct patterns of distribution across different sources. For instance, S. Enteritidis, S. I 4,,12: i-, S. Typhimurium, S. Thompson, and S. Uganda were found to be dominant in chicken, pork, duck, mutton, and beef respectively , suggesting potential host adaptation that might affect mdtI evolution.

How can researchers accurately assess the impact of mdtI mutations on Salmonella virulence and fitness?

Assessing the impact of mdtI mutations requires a comprehensive experimental approach:

Mutant Construction:

  • Generate precise mdtI mutations using CRISPR-Cas9 or lambda Red recombineering

  • Confirm mutations by sequencing and expression analysis

  • Create complemented strains to verify phenotype specificity

In vitro Assays:

  • Growth kinetics in various media conditions

  • Stress tolerance assays (pH, oxidative stress, antimicrobials)

  • Biofilm formation assessment

  • Cell invasion and intracellular survival in relevant cell lines

In vivo Models:

  • Colonization studies in appropriate animal models

  • Competitive index assays (wild-type vs. mutant)

  • Immune response characterization

  • Virulence assessment using standardized protocols

Data Analysis Framework:

  • Statistical comparison between wild-type, mutant, and complemented strains

  • Time-series analysis for growth and infection dynamics

  • Multivariate analysis to identify correlated phenotypes

Whole genome sequencing analyses have demonstrated that Salmonella isolates from different sources show varied SNP patterns, with some clusters containing isolates from multiple sources, suggesting potential transmission routes that should be considered when interpreting experimental results .

What methodology is recommended for investigating potential interactions between mdtI and other Salmonella virulence factors?

To systematically investigate mdtI interactions with other virulence factors:

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation:

    • Express epitope-tagged mdtI in Salmonella

    • Isolate membrane fractions and perform pull-downs

    • Identify interacting partners by mass spectrometry

  • Bacterial Two-Hybrid Assays:

    • Screen for interactions between mdtI and candidate partners

    • Validate positive hits through secondary assays

Genetic Interaction Analysis:

  • Generate single and double mutants of mdtI and other virulence genes

  • Perform epistasis analysis through phenotypic characterization

  • Construct transcriptional reporter fusions to assess regulatory interactions

Systems Biology Approaches:

  • Transcriptome analysis of mdtI mutants compared to wild-type

  • Proteome changes in membrane fractions upon mdtI mutation

  • Network analysis to identify functional clusters

The location of virulence genes on Salmonella pathogenicity islands (SPIs) should be considered, as multiple virulence genes associated with the type III secretion system have been identified on SPI-1 and SPI-2 , which might functionally interact with mdtI through direct or indirect mechanisms.

What strategies can resolve protein aggregation issues during recombinant mdtI purification?

Protein aggregation is a common challenge with membrane proteins like mdtI. Implement these methodological solutions:

Prevention Strategies:

  • Expression Optimization:

    • Reduce expression temperature (16-20°C)

    • Lower inducer concentration

    • Use specialized E. coli strains (C41, C43) designed for membrane proteins

  • Buffer Optimization:

    • Screen pH ranges (6.5-8.5)

    • Test various salt concentrations (100-500 mM NaCl)

    • Add stabilizing agents (glycerol 5-20%, arginine 50-200 mM)

Resolving Existing Aggregation:

  • Detergent Screening:

    • Systematic testing of detergent types and concentrations

    • Consider detergent mixtures for improved solubilization

  • Purification Modifications:

    • Include brief sonication steps to disrupt aggregates

    • Incorporate centrifugation steps (100,000 × g) before chromatography

    • Use on-column refolding protocols during affinity purification

Quality Control Methods:

  • Dynamic light scattering (DLS) to assess aggregation state

  • Size exclusion chromatography profiles

  • Negative stain electron microscopy

For storage and handling, reconstitution in deionized sterile water with 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C can help maintain protein stability .

How can researchers troubleshoot low expression yields of recombinant mdtI?

When facing low expression yields:

Systematic Optimization Approach:

ParameterVariables to TestAssessment Method
E. coli strainC41, C43, BL21(DE3), RosettaWestern blot analysis
Induction methodIPTG (0.1-1 mM), AutoinductionProtein yield comparison
Temperature16°C, 20°C, 25°C, 30°CActivity and yield balance
MediaLB, TB, 2×YT, M9Growth and expression
Induction timingEarly (OD₆₀₀ 0.4-0.6), Late (OD₆₀₀ 0.8-1.0)Expression profile analysis

Advanced Strategies:

  • Codon optimization for E. coli expression

  • Fusion tags to enhance solubility (MBP, SUMO, Trx)

  • Co-expression with chaperones or trafficking partners

  • Expression in membrane-targeted systems

For Salmonella proteins, comparative studies have shown that autoinduction methods can yield significantly higher protein amounts (>800 μg/2L culture) compared to IPTG induction (400 μg/2L culture) , suggesting this approach for mdtI optimization.

What controls and validation steps are essential when studying mdtI function in polyamine transport?

To ensure robust and reproducible results when studying mdtI function:

Essential Controls:

  • Genetic Controls:

    • mdtI knockout strain

    • mdtI overexpression strain

    • Complemented knockout strain

    • Empty vector controls

  • Functional Controls:

    • Known polyamine transport inhibitors

    • Structurally related but non-transported molecules

    • Ionophores to dissipate membrane potential

Validation Approaches:

  • Multiple Methodologies:

    • Combine transport assays with growth phenotypes

    • Validate in vitro findings with in vivo experiments

    • Cross-validate using heterologous expression systems

  • Specificity Testing:

    • Substrate range determination

    • Competition assays with unlabeled substrates

    • Structure-activity relationship studies

  • Quantitative Analysis:

    • Calculate transport kinetics (Km, Vmax)

    • Dose-response curves for inhibitors

    • Statistical analysis of replicate experiments

Proper experimental design with these controls and validation steps will strengthen the reliability of findings and facilitate interpretation of mdtI's role in polyamine transport.

What emerging technologies hold promise for advancing mdtI research?

The following cutting-edge approaches are poised to transform mdtI research:

Structural Biology Advances:

  • Cryo-EM for Membrane Proteins:

    • Single-particle analysis of purified mdtI

    • In situ structural determination in native membranes

  • Integrative Structural Biology:

    • Combining crystallography, NMR, and computational modeling

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

Functional Characterization:

  • Single-molecule Transport Assays:

    • Fluorescence-based detection of individual transport events

    • Correlation of structural dynamics with function

  • Nanobody Development:

    • Generation of conformation-specific nanobodies

    • Using nanobodies as crystallization chaperones

Systems Approaches:

  • Multi-omics Integration:

    • Correlating mdtI expression with metabolome changes

    • Network analysis of polyamine transport systems

  • Machine Learning Applications:

    • Prediction of mdtI interactions and regulation

    • Identification of potential inhibitors through virtual screening

These technologies will provide unprecedented insights into mdtI structure, function, and biological significance.

How might mdtI research contribute to development of novel antimicrobial strategies?

Given the increasing challenge of antimicrobial resistance in Salmonella strains , mdtI research could contribute to novel therapeutic approaches:

Inhibitor Development:

  • Structure-based Drug Design:

    • Virtual screening against mdtI structural models

    • Fragment-based approaches to identify binding pockets

  • High-throughput Screening:

    • Fluorescence-based transport assays adaptable to HTS

    • Phenotypic screens in mdtI-dependent conditions

Combination Therapies:

  • Sensitization Strategies:

    • Targeting mdtI to increase susceptibility to existing antibiotics

    • Identifying synergistic combinations through checkerboard assays

  • Anti-virulence Approaches:

    • Investigating mdtI's role in stress adaptation during infection

    • Targeting polyamine homeostasis to attenuate virulence

Delivery Systems:

  • Trojan Horse Strategies:

    • Utilizing mdtI substrate recognition for antibiotic delivery

    • Development of substrate-antibiotic conjugates

Recent genomic analyses have revealed multiple antimicrobial resistance genes in clinical Salmonella Enteritidis isolates , highlighting the urgent need for novel antimicrobial approaches that could potentially target transport systems like mdtI.

What interdisciplinary approaches could enhance our understanding of mdtI's role in Salmonella pathogenesis?

Interdisciplinary research holds promise for comprehensive insights:

Immunology-Microbiology Interface:

  • Study how mdtI-mediated polyamine export affects host immune responses

  • Investigate polyamine sensing by host pattern recognition receptors

  • Examine effects on inflammatory signaling pathways

Systems Biology-Biophysics Integration:

  • Develop quantitative models of polyamine transport kinetics

  • Simulate impact of mdtI activity on cellular physiology

  • Predict emergent behaviors from molecular interactions

Clinical Microbiology-Genomics Collaboration:

  • Correlate mdtI sequence variations with clinical outcomes

  • Analyze mdtI expression in patient isolates

  • Identify potential biomarkers for treatment response

Computational-Experimental Synergy:

  • Use machine learning to predict functional consequences of mdtI mutations

  • Design targeted experiments to validate computational hypotheses

  • Develop predictive models for rapid screening of clinical isolates

These interdisciplinary approaches align with emerging paradigms in biomedical research and hold promise for translating basic mdtI research into clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.