Recombinant Salmonella enteritidis PT4 Spermidine export protein MdtI (mdtI) is a bioengineered protein derived from Salmonella enteritidis serovar Enteritidis PT4, a pathogenic bacterium commonly linked to foodborne illnesses. This protein belongs to the small multidrug resistance (SMR) family and functions as part of a spermidine export complex, critical for maintaining cellular polyamine homeostasis. MdtI is expressed as a recombinant product in E. coli systems, typically with a histidine (His) tag for purification and structural stability .
| Attribute | Detail |
|---|---|
| Gene Name | mdtI (SEN1566) |
| Uniprot ID | B5QUE3 |
| Protein Length | Full-length (1-109 amino acids) |
| AA Sequence | MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA |
| Tag | N-terminal His-tag |
| Purity | >90% (SDS-PAGE) |
Vaccine Development: Recombinant MdtI could serve as an antigen in subunit vaccines targeting Salmonella Enteritidis .
Pathogenicity Studies: Investigating MdtI’s role in stress response and host colonization .
Spermidine Toxicity Rescue: In E. coli, MdtJI expression rescues viability under high spermidine concentrations by reducing intracellular levels .
Genome Context: In Salmonella Enteritidis PT4, mdtI is not part of pathogenicity islands (SPIs) but is conserved in non-typhoidal Salmonella .
Catalyzes the excretion of spermidine.
KEGG: set:SEN1566
While various expression systems can be employed, E. coli remains the predominant host for recombinant mdtI production . When selecting an expression system, researchers should consider:
Methodology:
The primary expression system utilized is E. coli, which offers robust protein yields and established protocols
The gene encoding mdtI is typically cloned into expression vectors containing:
An inducible promoter (e.g., T7 or lac promoter)
A His-tag sequence for purification
Appropriate antibiotic resistance markers for selection
Transformation is performed using standard protocols in competent E. coli cells
Expression is induced using IPTG or autoinduction methods
Based on comparable Salmonella protein expression studies, the E. coli strain C41 might offer superior yields compared to other strains such as Rosetta, Turner, C43, Origami, BL21pLys, or Rosetta pLys .
Purification of recombinant mdtI requires careful consideration of its membrane-associated properties. The following methodology has proven effective:
Cell Lysis Protocol:
Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)
Resuspend in lysis buffer containing:
50 mM Tris-HCl, pH 8.0
300 mM NaCl
10 mM imidazole
Protease inhibitor cocktail
Lyse cells using sonication or mechanical disruption
Membrane Protein Extraction:
Centrifuge lysate (20,000 × g, 30 min, 4°C) to pellet inclusion bodies and cell debris
Isolate membrane fraction through ultracentrifugation (100,000 × g, 1 hr, 4°C)
Solubilize membrane proteins using a detergent-based buffer (e.g., 1-2% n-dodecyl-β-D-maltoside)
Affinity Chromatography:
Apply solubilized protein to Ni-NTA resin
Wash with buffer containing 20-40 mM imidazole
Elute purified protein using an imidazole gradient (50-300 mM)
Further Purification Steps:
Size exclusion chromatography to separate monomers from aggregates
Ion exchange chromatography for removal of contaminants
For lyophilized recombinant mdtI protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C .
Functional characterization of mdtI as a spermidine export protein requires specialized methodologies:
Spermidine Transport Assays:
In vivo assays:
Generate mdtI knockout and mdtI-overexpressing strains
Expose bacterial cells to radiolabeled spermidine (³H-spermidine)
Measure intracellular vs. extracellular spermidine levels over time
Compare transport rates between wild-type, knockout, and overexpression strains
Proteoliposome reconstitution:
Incorporate purified mdtI into liposomes
Establish spermidine gradient across liposomal membrane
Measure spermidine transport using fluorescent spermidine analogs or radiolabeled spermidine
Assess effects of inhibitors and membrane potential on transport activity
Electrophysiological Characterization:
Patch-clamp analysis of mdtI-containing proteoliposomes or bacterial spheroplasts
Black lipid membrane (BLM) conductance measurements with reconstituted mdtI
For comprehensive functional analysis, researchers should employ multiple complementary approaches to validate transport activity and specificity.
To investigate mdtI expression and genomic contexts across Salmonella strains, researchers should employ:
Genomic Analysis:
Whole Genome Sequencing:
Illumina short-read sequencing (coverage >100×) for accurate SNP detection
PacBio or Oxford Nanopore long-read sequencing for complete genome assembly
Hybrid assembly approaches for optimal resolution
Comparative Genomics:
Analyze genomic context of mdtI using tools like SISTR for Salmonella isolates
Identify sequence variations in mdtI across serovars
Determine if mdtI is located on genomic islands or mobile genetic elements
Expression Analysis:
Transcriptomics:
RNA-Seq under various growth and stress conditions
qRT-PCR for targeted expression analysis
Promoter-reporter fusions to study regulation
Proteomics:
MS/MS analysis of membrane fractions
Targeted proteomics using selected reaction monitoring (SRM)
Western blot analysis with anti-mdtI antibodies
Recent genomic studies indicate that mdtI may be part of conserved genomic regions in Salmonella Enteritidis isolates. Analysis of 341 Salmonella isolates revealed that the core genome accounts for approximately one-quarter of the pangenome, suggesting mdtI may be part of this conserved core .
Integrating mdtI into RASV development requires careful consideration of:
Vector Construction:
Balanced-lethal vector-host systems to ensure plasmid stability without antibiotic selection
Regulated delayed synthesis systems for improved colonization and immune responses
Selection of appropriate promoters for controlled mdtI expression
Attenuation Strategies:
Regulated delayed attenuation to preserve vaccine strain viability during initial colonization
Consider mdtI expression timing relative to other vaccine antigens
Ensure appropriate mdtI expression without compromising strain safety
Delivery and Immunogenicity:
Oral delivery considerations: protection from gastric environment
Assessment of immune responses:
Antibody production (IgG, IgA)
T-cell responses
Protection in challenge models
The RASV approach has been successfully employed for delivering heterologous antigens, and these strategies could be adapted for mdtI if it represents a potential vaccine target .
While mdtI functions primarily as a spermidine export protein, its potential contributions to antimicrobial resistance warrant investigation:
Polyamine Transport and Resistance:
Polyamines like spermidine can modulate bacterial susceptibility to antibiotics by:
Altering membrane permeability
Neutralizing reactive oxygen species
Affecting biofilm formation
Methodological Approach:
Generate mdtI knockout and overexpression strains
Perform antimicrobial susceptibility testing using:
Broth microdilution method
Disk diffusion assays
Time-kill studies
Assess changes in minimum inhibitory concentrations (MICs) for different antibiotic classes
Investigate synergy between mdtI inhibition and conventional antibiotics
Recent genomic analyses have identified multiple antimicrobial resistance genes (ARGs) in Salmonella Enteritidis isolates, along with chromosomal point mutations in genes like gyrA and acrB . Understanding how mdtI interacts with these known resistance determinants could provide insights into novel therapeutic approaches.
Comparative analysis of mdtI with other Salmonella transport proteins reveals:
| Transporter | Size (aa) | Substrate | Function | Genomic Context |
|---|---|---|---|---|
| MdtI | 109 | Spermidine | Polyamine export | Often co-expressed with mdtJ |
| IciA | Varies | N/A | Chromosome initiation inhibitor | Regulatory regions |
| Hsp60 | ~550 | N/A | Chaperone protein | Heat shock operon |
| AcrB | ~1000 | Multiple antibiotics | Multidrug efflux | acrAB-tolC operon |
Methodological Approaches for Comparative Studies:
Structural comparison using homology modeling and crystallography
Functional characterization through complementation studies
Evolutionary analysis using phylogenetic methods
Expression correlation analysis under various stress conditions
Understanding the relationships between mdtI and other transport systems provides context for its evolutionary and functional significance in Salmonella biology.
Membrane proteins like mdtI present unique challenges that require specialized approaches:
Solution: Screen multiple detergents (DDM, LDAO, FC-12) for optimal solubilization
Methodology: Systematic detergent screening with thermal stability assays
Solution: Optimize expression conditions through factorial design experiments
Methodology: Compare induction methods (IPTG vs. autoinduction), temperature, and host strains
Solution: Develop robust proteoliposome systems with controlled lipid composition
Methodology: Systematic optimization of protein:lipid ratios and reconstitution protocols
Solution: Combine complementary structural biology approaches
Methodology: Cryo-EM, X-ray crystallography, and NMR for different structural aspects
Comparative studies on recombinant Salmonella Enteritidis proteins indicate that autoinduction methods may yield significantly higher protein amounts (>800 μg/2L culture) compared to IPTG induction (400 μg/2L culture) , which may be applicable to mdtI production.
To analyze mdtI evolution and conservation, researchers should implement:
Sequence Analysis Pipeline:
Homolog Identification:
BLAST searches against diverse Salmonella genomes
HMM-based approaches for distant homolog detection
Multiple Sequence Alignment:
MUSCLE or MAFFT for alignment of mdtI sequences
Manual curation of alignments in problematic regions
Phylogenetic Analysis:
Maximum Likelihood methods (RAxML, IQ-TREE)
Bayesian inference (MrBayes)
Selection of appropriate evolutionary models using ModelTest
Selection Pressure Analysis:
Calculate dN/dS ratios to identify selection signatures
Site-specific selection tests using PAML or HyPhy
Visualization and Interpretation:
Phylogenetic trees with annotated metadata (serovar, host, geography)
Protein structure mapping of conserved vs. variable regions
Recent genomic studies have revealed that Salmonella serovars show distinct patterns of distribution across different sources. For instance, S. Enteritidis, S. I 4,,12: i-, S. Typhimurium, S. Thompson, and S. Uganda were found to be dominant in chicken, pork, duck, mutton, and beef respectively , suggesting potential host adaptation that might affect mdtI evolution.
Assessing the impact of mdtI mutations requires a comprehensive experimental approach:
Mutant Construction:
Generate precise mdtI mutations using CRISPR-Cas9 or lambda Red recombineering
Confirm mutations by sequencing and expression analysis
Create complemented strains to verify phenotype specificity
In vitro Assays:
Growth kinetics in various media conditions
Stress tolerance assays (pH, oxidative stress, antimicrobials)
Biofilm formation assessment
Cell invasion and intracellular survival in relevant cell lines
In vivo Models:
Colonization studies in appropriate animal models
Competitive index assays (wild-type vs. mutant)
Immune response characterization
Virulence assessment using standardized protocols
Data Analysis Framework:
Statistical comparison between wild-type, mutant, and complemented strains
Time-series analysis for growth and infection dynamics
Multivariate analysis to identify correlated phenotypes
Whole genome sequencing analyses have demonstrated that Salmonella isolates from different sources show varied SNP patterns, with some clusters containing isolates from multiple sources, suggesting potential transmission routes that should be considered when interpreting experimental results .
To systematically investigate mdtI interactions with other virulence factors:
Protein-Protein Interaction Studies:
Co-immunoprecipitation:
Express epitope-tagged mdtI in Salmonella
Isolate membrane fractions and perform pull-downs
Identify interacting partners by mass spectrometry
Bacterial Two-Hybrid Assays:
Screen for interactions between mdtI and candidate partners
Validate positive hits through secondary assays
Genetic Interaction Analysis:
Generate single and double mutants of mdtI and other virulence genes
Perform epistasis analysis through phenotypic characterization
Construct transcriptional reporter fusions to assess regulatory interactions
Systems Biology Approaches:
Transcriptome analysis of mdtI mutants compared to wild-type
Proteome changes in membrane fractions upon mdtI mutation
Network analysis to identify functional clusters
The location of virulence genes on Salmonella pathogenicity islands (SPIs) should be considered, as multiple virulence genes associated with the type III secretion system have been identified on SPI-1 and SPI-2 , which might functionally interact with mdtI through direct or indirect mechanisms.
Protein aggregation is a common challenge with membrane proteins like mdtI. Implement these methodological solutions:
Prevention Strategies:
Expression Optimization:
Buffer Optimization:
Screen pH ranges (6.5-8.5)
Test various salt concentrations (100-500 mM NaCl)
Add stabilizing agents (glycerol 5-20%, arginine 50-200 mM)
Resolving Existing Aggregation:
Detergent Screening:
Systematic testing of detergent types and concentrations
Consider detergent mixtures for improved solubilization
Purification Modifications:
Include brief sonication steps to disrupt aggregates
Incorporate centrifugation steps (100,000 × g) before chromatography
Use on-column refolding protocols during affinity purification
Quality Control Methods:
Dynamic light scattering (DLS) to assess aggregation state
Size exclusion chromatography profiles
Negative stain electron microscopy
For storage and handling, reconstitution in deionized sterile water with 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C can help maintain protein stability .
When facing low expression yields:
Systematic Optimization Approach:
| Parameter | Variables to Test | Assessment Method |
|---|---|---|
| E. coli strain | C41, C43, BL21(DE3), Rosetta | Western blot analysis |
| Induction method | IPTG (0.1-1 mM), Autoinduction | Protein yield comparison |
| Temperature | 16°C, 20°C, 25°C, 30°C | Activity and yield balance |
| Media | LB, TB, 2×YT, M9 | Growth and expression |
| Induction timing | Early (OD₆₀₀ 0.4-0.6), Late (OD₆₀₀ 0.8-1.0) | Expression profile analysis |
Advanced Strategies:
Codon optimization for E. coli expression
Fusion tags to enhance solubility (MBP, SUMO, Trx)
Co-expression with chaperones or trafficking partners
Expression in membrane-targeted systems
For Salmonella proteins, comparative studies have shown that autoinduction methods can yield significantly higher protein amounts (>800 μg/2L culture) compared to IPTG induction (400 μg/2L culture) , suggesting this approach for mdtI optimization.
To ensure robust and reproducible results when studying mdtI function:
Essential Controls:
Genetic Controls:
mdtI knockout strain
mdtI overexpression strain
Complemented knockout strain
Empty vector controls
Functional Controls:
Known polyamine transport inhibitors
Structurally related but non-transported molecules
Ionophores to dissipate membrane potential
Validation Approaches:
Multiple Methodologies:
Combine transport assays with growth phenotypes
Validate in vitro findings with in vivo experiments
Cross-validate using heterologous expression systems
Specificity Testing:
Substrate range determination
Competition assays with unlabeled substrates
Structure-activity relationship studies
Quantitative Analysis:
Calculate transport kinetics (Km, Vmax)
Dose-response curves for inhibitors
Statistical analysis of replicate experiments
Proper experimental design with these controls and validation steps will strengthen the reliability of findings and facilitate interpretation of mdtI's role in polyamine transport.
The following cutting-edge approaches are poised to transform mdtI research:
Structural Biology Advances:
Cryo-EM for Membrane Proteins:
Single-particle analysis of purified mdtI
In situ structural determination in native membranes
Integrative Structural Biology:
Combining crystallography, NMR, and computational modeling
Hydrogen-deuterium exchange mass spectrometry for dynamics
Functional Characterization:
Single-molecule Transport Assays:
Fluorescence-based detection of individual transport events
Correlation of structural dynamics with function
Nanobody Development:
Generation of conformation-specific nanobodies
Using nanobodies as crystallization chaperones
Systems Approaches:
Multi-omics Integration:
Correlating mdtI expression with metabolome changes
Network analysis of polyamine transport systems
Machine Learning Applications:
Prediction of mdtI interactions and regulation
Identification of potential inhibitors through virtual screening
These technologies will provide unprecedented insights into mdtI structure, function, and biological significance.
Given the increasing challenge of antimicrobial resistance in Salmonella strains , mdtI research could contribute to novel therapeutic approaches:
Inhibitor Development:
Structure-based Drug Design:
Virtual screening against mdtI structural models
Fragment-based approaches to identify binding pockets
High-throughput Screening:
Fluorescence-based transport assays adaptable to HTS
Phenotypic screens in mdtI-dependent conditions
Combination Therapies:
Sensitization Strategies:
Targeting mdtI to increase susceptibility to existing antibiotics
Identifying synergistic combinations through checkerboard assays
Anti-virulence Approaches:
Investigating mdtI's role in stress adaptation during infection
Targeting polyamine homeostasis to attenuate virulence
Delivery Systems:
Trojan Horse Strategies:
Utilizing mdtI substrate recognition for antibiotic delivery
Development of substrate-antibiotic conjugates
Recent genomic analyses have revealed multiple antimicrobial resistance genes in clinical Salmonella Enteritidis isolates , highlighting the urgent need for novel antimicrobial approaches that could potentially target transport systems like mdtI.
Interdisciplinary research holds promise for comprehensive insights:
Immunology-Microbiology Interface:
Study how mdtI-mediated polyamine export affects host immune responses
Investigate polyamine sensing by host pattern recognition receptors
Examine effects on inflammatory signaling pathways
Systems Biology-Biophysics Integration:
Develop quantitative models of polyamine transport kinetics
Simulate impact of mdtI activity on cellular physiology
Predict emergent behaviors from molecular interactions
Clinical Microbiology-Genomics Collaboration:
Correlate mdtI sequence variations with clinical outcomes
Analyze mdtI expression in patient isolates
Identify potential biomarkers for treatment response
Computational-Experimental Synergy:
Use machine learning to predict functional consequences of mdtI mutations
Design targeted experiments to validate computational hypotheses
Develop predictive models for rapid screening of clinical isolates
These interdisciplinary approaches align with emerging paradigms in biomedical research and hold promise for translating basic mdtI research into clinical applications.