Recombinant Salmonella enteritidis PT4 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Salmonella enteritidis PT4 Spermidine Export Protein MdtJ (mdtJ) is a 120-amino-acid transmembrane protein encoded by the mdtJ gene (UniProt ID: B5QUE4). It belongs to the Small Multidrug Resistance (SMR) family and functions in spermidine efflux to mitigate intracellular toxicity . The recombinant variant is produced in E. coli with an N-terminal His tag, purified to >90% purity, and supplied as a lyophilized powder .

Table 2: Functional Residues in MdtJ

Residue PositionRole in Spermidine Export
Tyr⁴Substrate binding
Trp⁵Membrane localization
Glu¹⁵Proton antiport activity

Genomic Context

The mdtJ gene (locus SEN1567) is conserved in S. enteritidis PT4 and located within a genomic region syntenic with E. coli’s polyamine transport systems . Comparative genomics reveals:

  • Pathogenicity Islands: While not directly within SPI-1/SPI-2, mdtJ shares regulatory motifs with virulence-associated genes .

  • Phage Integration: Prophage ϕSE20 in S. enteritidis PT4 carries genes linked to host adaptation, though mdtJ itself is not phage-encoded .

Research Applications

  • Mechanistic Studies: Used to dissect spermidine transport kinetics and antibiotic resistance pathways .

  • Biochemical Assays: ELISA-compatible formulations enable protein interaction studies .

  • Therapeutic Targets: Potential for inhibiting spermidine efflux to sensitize bacteria to antimicrobials .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development according to your specifications.
Synonyms
mdtJ; SEN1567; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function
This protein catalyzes the excretion of spermidine.
Database Links

KEGG: set:SEN1567

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtJ protein and what is its function in Salmonella enteritidis?

MdtJ is a spermidine export protein found in Salmonella enteritidis PT4 that functions as part of a complex with MdtI (termed the MdtJI complex) to catalyze the excretion of spermidine from bacterial cells. This protein belongs to the small multidrug resistance (SMR) family of drug exporters . The primary function of the MdtJI complex is to regulate intracellular levels of spermidine, which can become toxic when overaccumulated in bacterial cells. Studies have shown that both mdtJ and mdtI are necessary for recovery from spermidine toxicity .

Methodological approach: Researchers typically utilize spermidine acetyltransferase-deficient E. coli strains to examine the role of MdtJ in spermidine export. By transforming these strains with plasmids encoding MdtJ and MdtI (such as pUCmdtJI or pMWmdtJI), and measuring cell growth, viability, and spermidine content under various conditions, the protein's contribution to spermidine homeostasis can be quantified .

How does the MdtJI complex work in bacterial cells?

The MdtJI complex functions as a heterodimeric membrane protein complex that serves as an efflux pump to export spermidine from bacterial cells. Experimental evidence demonstrates that:

  • When intracellular spermidine levels increase, the expression of mdtJI mRNA is upregulated, suggesting a regulatory feedback mechanism .

  • The complex catalyzes the active transport of spermidine across the cell membrane, reducing intracellular spermidine to non-toxic levels.

  • Cells expressing functional MdtJI complex show decreased spermidine content when cultured in the presence of 2 mM spermidine .

  • The excretion of spermidine from cells is enhanced by the MdtJI complex, providing direct evidence of its transport function .

Research methodologies for studying MdtJI function include measuring intracellular spermidine content using analytical techniques such as HPLC, analyzing spermidine excretion from cells using radiolabeled compounds, and quantifying mdtJI mRNA levels using RT-PCR in response to varying spermidine concentrations.

How is MdtJ protein expression regulated in Salmonella?

Studies have demonstrated that mdtJI mRNA levels increase in response to elevated spermidine concentrations , suggesting a transcriptional regulatory mechanism. This regulatory response allows Salmonella to adjust MdtJ expression based on the cellular need for spermidine export, providing a homeostatic control mechanism.

Experimental approaches to study MdtJ regulation include:

  • Quantitative RT-PCR to measure mdtJ mRNA levels under different conditions and stress factors

  • Promoter-reporter fusion assays to identify regulatory elements controlling mdtJ expression

  • Transcriptomic analysis to place mdtJ regulation within the broader cellular response network

  • Identification of transcription factors that may bind to the mdtJ promoter region

While specific regulatory proteins controlling mdtJ expression have not been fully characterized in the provided search results, the induction of expression by spermidine suggests the existence of a sensory and regulatory mechanism responsive to polyamine levels.

What is the relationship between MdtJ and antimicrobial resistance?

As a member of the small multidrug resistance (SMR) family of drug exporters , MdtJ has potential implications for antimicrobial resistance in Salmonella. While its primary function appears to be spermidine export, its structural characteristics suggest possible overlap with mechanisms of drug resistance.

The emergence of multidrug-resistant (MDR) Salmonella Enteritidis strains poses a serious public health challenge . Various mechanisms contribute to antimicrobial resistance in Salmonella, including:

  • Mobile genetic elements (MGEs) such as plasmids, prophages, and genomic islands

  • Chromosomal point mutations in genes like gyrA and acrB

  • Efflux pumps that can export antibiotics from the cell

While the direct contribution of MdtJ to antibiotic resistance requires further investigation, understanding its function as part of the broader context of bacterial efflux systems is important for comprehending multidrug resistance mechanisms in Salmonella.

What experimental approaches are most effective for studying MdtJ function in vivo?

Several sophisticated experimental approaches can be employed to study MdtJ function in bacterial cells:

  • Gene knockout and complementation studies: Creating mdtJ deletion mutants followed by complementation with wild-type or mutated versions of the gene can establish the protein's role in spermidine export and cell survival. This approach was used to demonstrate that both mdtJ and mdtI are necessary for recovery from spermidine toxicity .

  • In vivo spermidine transport assays: Quantitative measurement of spermidine content in cells cultured in the presence of exogenous spermidine (e.g., 2 mM) can reveal the efficiency of MdtJ-mediated export . This can be combined with radiolabeled spermidine to track its movement across the cell membrane.

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or FRET can investigate the interaction between MdtJ and MdtI or other potential partners.

  • Site-directed mutagenesis: Systematic mutation of specific amino acid residues (such as Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) followed by functional assays can identify residues critical for transport activity .

  • Transcriptional reporter assays: Using reporters fused to the mdtJ promoter to monitor regulation in response to various stimuli, particularly changes in spermidine concentration.

These approaches can be complemented by whole-genome sequencing and comparative genomics methods that have been effectively applied to Salmonella Enteritidis , providing a broader context for understanding MdtJ function in diverse strains.

How can researchers effectively express and purify recombinant MdtJ for structural studies?

The expression and purification of membrane proteins like MdtJ present unique challenges due to their hydrophobic nature. A systematic approach includes:

  • Expression system selection: While E. coli is commonly used, alternative systems may be considered for optimal expression. The choice should be guided by the specific research questions and downstream applications.

  • Fusion tags and constructs: The tag type for MdtJ is often determined during the production process to ensure optimal protein stability and activity . Common options include His6, FLAG, or MBP tags to facilitate purification.

  • Solubilization and purification protocol:

    • Use of appropriate detergents to solubilize membrane proteins

    • Affinity chromatography based on the chosen tag

    • Size exclusion chromatography for further purification

    • Buffer optimization (a Tris-based buffer with 50% glycerol has been reported as effective for MdtJ storage)

  • Storage conditions: Purified MdtJ can be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is recommended. Working aliquots can be stored at 4°C for up to one week, and repeated freezing and thawing should be avoided .

  • Functional validation: Activity assays or binding studies to confirm that the purified protein retains its native function.

For structural studies such as X-ray crystallography or cryo-EM, additional considerations include protein stability, homogeneity, and concentration requirements specific to each technique.

What are the key amino acid residues in MdtJ critical for function, and how were they identified?

Research has identified several key amino acid residues in MdtJ that are critical for its spermidine excretion activity: Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 . These residues were identified through systematic mutagenesis approaches and functional characterization.

The methodological workflow typically includes:

  • Bioinformatic analysis to identify conserved residues across MdtJ homologs

  • Site-directed mutagenesis to systematically replace targeted residues

  • Functional complementation assays to test the ability of mutant proteins to restore spermidine resistance

  • Spermidine transport measurements to quantify the impact of mutations on export efficiency

The identification of both aromatic (Tyr4, Trp5, Tyr45, Tyr61) and acidic (Glu15, Glu82) residues suggests their involvement in forming a substrate binding pocket or transport channel. The acidic residues may interact with the positively charged spermidine molecule through ionic interactions, while the aromatic residues could participate in cation-π interactions or contribute to the structural integrity of the transport pathway.

This structure-function relationship information is crucial for understanding the molecular mechanism of spermidine export and potentially for designing inhibitors or modulators of MdtJ activity.

How does the MdtJI complex contribute to Salmonella pathogenicity?

The contribution of the MdtJI complex to Salmonella pathogenicity is multifaceted, involving both direct and indirect mechanisms:

  • Polyamine homeostasis during infection: By regulating intracellular spermidine levels, the MdtJI complex helps Salmonella adapt to varying environmental conditions encountered during infection, potentially including the polyamine-rich intestinal environment.

  • Stress response and adaptation: Polyamines like spermidine play roles in bacterial stress responses, which are critical during host colonization and immune evasion.

  • Interaction with virulence mechanisms: While not directly established for MdtJ, the function of efflux systems can interact with virulence factor expression. Multiple virulence genes associated with the type III secretion system have been identified on Salmonella pathogenicity islands (SPIs) SPI-1 and SPI-2 in Salmonella Enteritidis .

  • Contribution to genomic lineages associated with outbreaks: Genomic studies have revealed that the majority of the global S. Enteritidis population falls within two predominant lineages with significantly different propensities for causing large-scale outbreaks . The distribution and variation of genes like mdtJ across these lineages may contribute to differences in virulence.

Research methodologies to investigate these connections include comparative genomics of outbreak and non-outbreak strains, transcriptomic analysis of mdtJ expression during infection models, and phenotypic characterization of mdtJ mutants in virulence-related assays such as cell invasion and intracellular survival.

What advanced genomic methods can be used to study MdtJ evolution and diversity?

Advanced genomic approaches provide powerful tools for studying the evolution and diversity of MdtJ across Salmonella strains:

  • Multilevel genome typing (MGT): This approach has been successfully applied to S. Enteritidis, revealing both globally prevalent and regionally restricted sequence types . Application to mdtJ specifically can identify variations that may correlate with functional differences.

  • Whole genome sequencing and comparative analysis: WGS has been used to characterize antimicrobial resistance and virulence factors in S. Enteritidis isolates . This approach can place mdtJ in the context of the broader genome and identify associated mobile genetic elements.

  • Phylogenetic analysis with temporal and geographical mapping: Analysis of 26,670 S. Enteritidis genome sequences spanning 101 years from 86 countries has revealed spatial and temporal distributions of sequence types . Similar approaches focused on mdtJ can track its evolution over time and space.

  • Selection pressure analysis: Calculating dN/dS ratios for mdtJ can identify whether it is under purifying, neutral, or positive selection in different lineages.

  • Structural variation analysis: Beyond single nucleotide polymorphisms, structural variations in the mdtJ gene or its regulatory regions can be identified through appropriate bioinformatic pipelines.

MGT LevelResolutionApplication to MdtJ Study
Lower levels (MGT3-4)Broader lineagesIdentify major evolutionary groups of MdtJ
Middle levels (MGT5-6)Medium resolutionTrack temporal trends in MdtJ variants
Higher levels (MGT7-9)Fine resolutionIdentify specific mutations for functional studies

These genomic approaches can be integrated with experimental data to provide a comprehensive understanding of MdtJ evolution and its functional implications in different Salmonella strains and lineages.

How does spermidine export via MdtJ affect cellular physiology in Salmonella enteritidis?

The impact of MdtJ-mediated spermidine export on Salmonella cellular physiology extends beyond simple detoxification:

  • Protection against spermidine toxicity: Experimental evidence shows that the MdtJI complex protects cells from the toxic effects of spermidine overaccumulation, with both proteins being necessary for this protective effect .

  • Feedback regulation: The increase in mdtJI mRNA levels in response to spermidine suggests a regulatory network that maintains polyamine homeostasis, with potential widespread effects on cellular physiology.

  • Metabolic implications: Polyamines like spermidine interact with nucleic acids and proteins, affecting processes including protein synthesis, gene expression, and stress response. MdtJ's role in regulating spermidine levels thus has broad metabolic consequences.

  • Energy utilization: As an active transport process, spermidine export via MdtJ likely requires energy input, affecting cellular energetics.

Research approaches to investigate these physiological effects include:

  • Global transcriptomic and proteomic analysis of wildtype versus mdtJ mutant strains

  • Metabolomic profiling to identify changes in cellular metabolism

  • Growth and stress response phenotyping under various environmental conditions

  • Measurement of spermidine-dependent cellular processes such as biofilm formation

Understanding these physiological impacts provides insight into how MdtJ contributes to Salmonella's adaptability in different environments, including during infection.

What methodologies can be used to study the interaction between MdtJ and MdtI proteins?

The functional interdependence of MdtJ and MdtI necessitates detailed study of their interaction. Several methodological approaches can be employed:

  • Genetic co-expression studies: Research has demonstrated that both mdtJ and mdtI are necessary for recovery from spermidine toxicity , indicating the need for both proteins in forming a functional complex.

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of the purified complex

    • NMR spectroscopy for dynamic interaction studies

    • Computational modeling and molecular dynamics simulations

  • Protein-protein interaction techniques:

    • Co-immunoprecipitation with antibodies against one protein to pull down the complex

    • Bacterial two-hybrid or split-GFP assays to detect interactions in vivo

    • Cross-linking studies followed by mass spectrometry to identify interaction interfaces

  • Functional complementation with chimeric proteins: Creating fusion proteins or domain swaps between MdtJ and MdtI to identify critical interaction regions.

  • Mutational analysis of interface residues: Systematic mutation of residues at potential interaction sites followed by functional assays and interaction studies.

A combined approach using multiple techniques provides the most comprehensive understanding of how these proteins interact to form a functional spermidine export complex. This information is crucial for understanding the molecular mechanism of spermidine export and potentially for designing modulators of this process.

How can MdtJ research contribute to addressing multidrug resistance in Salmonella?

The study of MdtJ has significant implications for addressing the growing concern of multidrug resistance in Salmonella Enteritidis:

  • Understanding efflux mechanisms: As part of the SMR family of drug exporters , insights from MdtJ structure and function may illuminate broader principles of bacterial efflux systems that contribute to antimicrobial resistance.

  • Efflux pump inhibitor development: Detailed knowledge of MdtJ's structure and mechanism could inform the design of efflux pump inhibitors that might restore antibiotic sensitivity in resistant strains.

  • Identification of resistance markers: Genomic studies of S. Enteritidis have revealed various antimicrobial resistance mechanisms, including chromosomal point mutations and plasmid-borne resistance genes . Understanding the relationship between MdtJ variants and resistance phenotypes could identify new resistance markers.

  • Evolutionary insights: The multilevel genome typing approach applied to S. Enteritidis could be used to track the co-evolution of mdtJ with other resistance determinants, providing epidemiological insights.

  • Novel therapeutic approaches: If MdtJ proves essential for Salmonella survival under certain conditions, it could represent a novel therapeutic target.

Research has identified multidrug resistance-associated sequence types at various MGT levels in S. Enteritidis , improving precision of detection and global tracking of MDR clones. Integrating MdtJ research into these broader genomic epidemiology frameworks could enhance our understanding of resistance mechanisms and inform public health interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.