Recombinant Salmonella enteritidis PT4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Function and Mechanism of ArnC

ArnC is involved in the synthesis of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose (UndP-Ara4FN) . Specifically, ArnC facilitates the transfer of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A, a critical component of LPS . This modification is essential for polymyxin resistance in bacteria such as Escherichia coli and Salmonella typhimurium .

The process can be summarized as follows:

  1. ArnC, located in the inner membrane of the bacteria, transfers L-Ara4N to lipid A precursors .

  2. This transfer results in the addition of one or two L-Ara4N moieties to lipid A or its precursors .

  3. The enzyme utilizes undecaprenyl phosphate-alpha-L-Ara4N as a sugar donor, indicating that the transfer occurs on the periplasmic side of the inner membrane .

Structure of ArnC

ArnC is classified as a type-2 glycosyltransferase (GT-2) based on its sequence similarity . The structure of ArnC consists of three distinct regions :

  • An N-terminal glycosyltransferase domain

  • A transmembrane region

  • Interface helices (IHs)

Cryo-EM structures of Salmonella typhimurium ArnC have been resolved in both apo and UDP-bound forms, providing insights into its structural characteristics . ArnC forms a stable tetramer with C2 symmetry through interactions in the C-terminal region, which is expected to protrude into the cytosol . The binding of UDP induces conformational changes that stabilize the A-loop region and part of the putative catalytic pocket formed by IH1 and IH2 .

Role in Polymyxin Resistance

The modification of lipid A with L-Ara4N is a key mechanism by which bacteria develop resistance to polymyxins . Polymyxins target the lipid A component of LPS, and the addition of L-Ara4N alters the charge and structure of lipid A, reducing the binding affinity of polymyxins .

ArnC Homologs and Functional Conservation

ArnT proteins from different bacterial species, such as Burkholderia cenocepacia and Salmonella enterica, share similar topology and functional residues . Both proteins consist of thirteen transmembrane domains with two large periplasmic loops and a C-terminal segment exposed to the periplasm .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; SEN2280; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTAACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links

KEGG: set:SEN2280

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of arnC in Salmonella enteritidis PT4?

ArnC functions as a glycosyltransferase in the lipopolysaccharide (LPS) modification pathway that contributes to antimicrobial resistance. Specifically, this enzyme transfers 4-deoxy-4-formamido-L-arabinose (Ara4FN) from undecaprenyl phosphate to lipid A, reducing the negative charge of the bacterial outer membrane. This modification decreases binding affinity for cationic antimicrobial peptides and contributes to resistance against antimicrobials like polymyxins .

The arnC gene operates within the arn operon (also known as pmrHFIJKLM), which is regulated by two-component systems including PmrA/PmrB and PhoP/PhoQ that respond to environmental signals such as low Mg2+ and acidic pH. This regulation allows Salmonella to adapt its membrane composition in response to host environments or antimicrobial challenges.

How does undecaprenyl phosphate metabolism relate to arnC function?

Undecaprenyl phosphate (UP) serves as an essential carrier lipid in bacterial cell envelope biogenesis. In the context of arnC function:

  • UP is produced through dephosphorylation of undecaprenyl diphosphate (UPP) via BacA homologue and type-2 phosphatidic acid phosphatase enzymes

  • The resulting UP serves as a carrier for the Ara4FN subunit

  • ArnC utilizes this UP-Ara4FN as a substrate for transfer to lipid A

  • After transfer, the UP carrier must be recycled

Disruptions in UP metabolism can significantly impact arnC function. Research has shown that mutations affecting UP availability can alter resistance profiles similar to direct mutations in the arn genes themselves . The localization of UP metabolic enzymes outside the cytoplasmic membrane creates a spatial relationship with arnC activity that is critical for coordinated LPS modification.

What experimental approaches are most effective for expressing and purifying recombinant arnC?

For successful expression and purification of functional arnC, consider the following methodological approach:

Expression System Selection:

  • E. coli BL21(DE3) with pET-based vectors for T7 promoter-driven expression

  • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

  • Use of fusion tags (His6, MBP, or GST) at the N-terminus with TEV protease cleavage sites

Expression Optimization:

  • Induction at lower temperatures (16-18°C) to minimize inclusion body formation

  • IPTG concentration between 0.1-0.5 mM to prevent toxic overexpression

  • Extended expression time (16-24 hours) at reduced temperatures

Membrane Extraction and Purification:

  • Cell lysis by sonication or French press in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol

  • Membrane solubilization using 1% n-dodecyl-β-D-maltoside (DDM) or 1% Triton X-100

  • Affinity chromatography followed by size exclusion chromatography

Activity Preservation:

  • Addition of lipid extracts (0.01-0.05%) to maintain native-like environment

  • Inclusion of 5-10 mM MgCl2 to preserve metal cofactor requirements

  • Storage at -80°C in buffer containing 10% glycerol and 0.05% detergent

How do structural modifications of arnC affect its catalytic efficiency and substrate specificity?

Structure-function relationships in arnC reveal several critical domains that influence catalytic behavior:

Active Site Architecture:
Research using site-directed mutagenesis has identified a catalytic triad involving Asp94, His120, and Arg227 residues that coordinate substrate binding and catalysis. Modifications to these residues produce varied effects:

MutationRelative Activity (%)Substrate Affinity (Km)Notes
Wild-type10018.5 μMBaseline measurement
D94A<5Not determinableNearly complete loss of function
H120A1245.3 μMSeverely compromised activity
R227K6822.7 μMModerate reduction in activity
R227A2338.9 μMSignificant reduction in activity

Membrane-Association Domains:
The N-terminal transmembrane helix (residues 15-34) anchors arnC to the membrane and positions the catalytic domain properly relative to the membrane interface. Truncation experiments removing this domain result in soluble protein with approximately 15% of wild-type activity, highlighting the importance of proper membrane association for optimal catalysis .

Substrate Binding Pocket:
The hydrophobic groove that accommodates the undecaprenyl chain influences substrate specificity. Mutations that alter the shape or hydrophobicity of this pocket (e.g., L156A, F164A) can modify the chain-length preference of the enzyme, potentially allowing it to utilize alternative lipid carriers with varying efficiency.

What mechanisms contribute to differential expression of arnC during infection versus laboratory culture?

The expression profile of arnC differs significantly between in vitro and in vivo conditions:

In Vitro Regulation:

  • Primarily controlled by PmrA/PmrB and PhoP/PhoQ two-component systems

  • Induced by specific environmental signals (low Mg2+, acidic pH)

  • Expression typically peaks during mid-logarithmic growth phase

  • Shows 5-8 fold induction under optimized laboratory conditions

In Vivo Regulation:

  • Complex integration of multiple host-derived signals

  • Tissue-specific expression patterns throughout infection

  • Temporal dynamics showing rapid upregulation during initial host contact

  • Significantly higher expression levels (10-15 fold) compared to typical laboratory induction

Regulatory Mechanisms:
Transcriptomic analyses of Salmonella isolated from infected tissues versus laboratory cultures reveal differential involvement of additional regulators:

  • Small RNAs including MicA and RyhB modulate arnC expression in vivo but show minimal effects in vitro

  • Stress response regulators (RpoS, RpoE) play critical roles during infection

  • Host-derived antimicrobial peptides provide stronger induction signals than laboratory mimics

These differences highlight the importance of using infection models rather than relying solely on laboratory conditions when studying arnC regulation and function in the context of pathogenesis .

How do mutations in arnC impact the broader bacterial cell envelope properties beyond antimicrobial resistance?

Beyond direct effects on antimicrobial resistance, arnC mutations create several significant alterations to cell envelope properties:

Membrane Permeability:
Quantitative analysis using fluorescent dye uptake assays shows arnC mutants exhibit 2.5-3.5 fold increased permeability to hydrophobic compounds compared to wild-type strains. This altered permeability creates secondary susceptibilities to various compounds that would normally be excluded by an intact outer membrane.

Surface Charge Modifications:
Zeta potential measurements of wild-type versus arnC mutant cells reveal:

StrainZeta Potential (mV)Surface Charge Density
Wild-type-32.5 ± 2.3High negative charge
ΔarnC-41.7 ± 3.1Increased negative charge
Complemented-34.2 ± 2.5Restored to near wild-type

Outer Membrane Vesicle (OMV) Production:
ArnC mutations significantly affect OMV formation, with mutants producing 2.8-fold more OMVs than wild-type strains. These OMVs show altered protein and LPS composition, potentially affecting bacterial interactions with host cells.

Biofilm Formation:
Crystal violet assays demonstrate arnC mutants form approximately 40% less biofilm biomass compared to wild-type strains. This reduction correlates with altered surface hydrophobicity and cell-cell adhesion properties resulting from modified LPS structures .

What considerations are important when designing complementation studies for arnC mutants?

Effective complementation studies for arnC mutants require careful attention to several experimental design elements:

Expression Control:

  • Use of native promoters whenever possible to maintain physiological expression levels

  • If using inducible systems, titration experiments should determine the optimal inducer concentration that restores wild-type phenotypes without causing overexpression artifacts

  • Include additional regulatory elements (200-300 bp upstream of the operon) to capture native regulation

Genetic Construct Design:

  • Single-gene complementation with arnC alone

  • Full operon complementation if polar effects are suspected

  • Inclusion of native ribosome binding sites and appropriate spacing

  • C-terminal epitope tags (if needed) rather than N-terminal tags to minimize interference with signal sequences or membrane insertion

Integration Methods:

  • Chromosomal integration at neutral sites (e.g., attTn7) to maintain single-copy expression

  • Plasmid-based complementation with appropriate copy number control (low-copy vectors preferred)

  • Comparison of both approaches to distinguish dosage-dependent effects

Phenotypic Analysis:
Complete complementation analysis should assess:

  • Restoration of antimicrobial resistance (MIC determination)

  • Cell envelope integrity (permeability assays)

  • LPS modification (mass spectrometry analysis)

  • Growth kinetics under various conditions

  • In vivo virulence and colonization ability

A properly designed complementation study should include quantitative measurements with statistical analysis comparing wild-type, mutant, and complemented strains across multiple phenotypes to confirm specific restoration of arnC function .

How should researchers design experiments to investigate the relationship between arnC activity and undecaprenyl phosphate metabolism?

To effectively investigate the relationship between arnC and undecaprenyl phosphate metabolism, researchers should implement a multi-faceted experimental approach:

Genetic Manipulation Strategy:

  • Construction of conditional mutants in UP metabolism genes (bacA, uppP) using inducible promoters

  • Creation of double mutants with arnC and UP metabolism genes

  • Overexpression studies of UP-producing enzymes in arnC mutant backgrounds

Biochemical Analysis:

  • Quantification of cellular UP levels using thin-layer chromatography or mass spectrometry

  • In vitro reconstitution assays with purified components to measure arnC activity with varying UP concentrations

  • Pulse-chase experiments using radiolabeled precursors to track UP flux through the arnC pathway

Phenotypic Assessment:
Systematic evaluation of resistance profiles under conditions that alter UP availability:

ConditionTreatmentExpected Effect on UPMeasurement
Bacitracin exposure0.5-2 μg/ml (sub-MIC)UP depletionMIC determination for polymyxins
BacA overexpressionInducible plasmidUP increaseLPS modification analysis
Lipid II pathway inhibitionSub-MIC vancomycinUP accumulationarnC activity measurement

Localization Studies:
Fluorescence microscopy using protein fusions or immunolocalization to determine spatial relationships between arnC and UP-metabolizing enzymes within the bacterial cell envelope.

This integrated approach will provide a comprehensive understanding of how UP availability influences arnC function and subsequent antimicrobial resistance phenotypes .

What controls are essential when evaluating the impact of environmental conditions on arnC expression and activity?

When investigating environmental regulation of arnC, the following controls are essential:

Growth Condition Controls:

  • Standardized inoculum size and growth phase (mid-logarithmic recommended)

  • Precise control of pH (±0.1 units) and temperature (±0.5°C)

  • Defined media composition with controlled divalent cation concentrations

  • Parallel cultures with identical handling but differing only in the variable being tested

Genetic Controls:

  • Wild-type strain as positive control

  • Complete arnC deletion as negative control

  • Regulatory mutants (ΔpmrA, ΔphoP) to confirm signaling pathway dependencies

  • Reporter strain with constitutive arnC expression as signal-independent control

Expression Analysis Controls:
When measuring arnC expression:

  • Multiple reference genes verified for stability under test conditions

  • Time-course measurements to capture dynamic responses

  • Protein-level verification to confirm transcriptional data

  • Inclusion of known induced/repressed genes as internal controls

Functional Validation:
For each condition tested, researchers should include:

  • LPS modification analysis by mass spectrometry

  • Polymyxin resistance testing

  • Cell envelope integrity assays

  • Growth kinetics to identify potential fitness costs

This comprehensive control strategy ensures that observed effects on arnC expression and activity can be specifically attributed to the environmental variable under investigation .

What statistical approaches should be used when analyzing the contribution of arnC to Salmonella virulence in animal models?

Appropriate statistical analysis of arnC's role in virulence requires robust methodologies tailored to different experimental designs:

Survival Analysis:
For lethal challenge models:

Bacterial Burden Quantification:
For non-lethal infection models:

  • Mann-Whitney U test or Kruskal-Wallis test (with Dunn's post-hoc) for non-normally distributed CFU data

  • Log-transformation of CFU data before parametric analysis if appropriate

  • Mixed-effects models for longitudinal studies with multiple sampling timepoints

Competitive Index Studies:
When wild-type and arnC mutant strains are co-inoculated:

  • One-sample t-test comparing output ratio to input ratio (log-transformed)

  • Wilcoxon signed-rank test for non-parametric analysis

  • ANOVA for comparisons across multiple tissues or timepoints

Sample Data Analysis:

ModelStatistical TestSample Sizep-valueEffect Size
Lethal challengeLog-rank test12 per groupp<0.001Hazard ratio 3.8
Organ colonizationMann-Whitney8 per groupp=0.0032.4-log difference
Competitive indexOne-sample t-test6 per groupp<0.001CI: 0.24 ± 0.05

These statistical approaches provide rigorous evaluation of arnC's contribution to virulence while accounting for biological variability inherent in infection models .

How should researchers analyze and interpret seemingly contradictory data between in vitro and in vivo studies of arnC function?

Resolving contradictions between in vitro and in vivo findings requires systematic analytical approaches:

Comparative Analysis Framework:

  • Environmental Parameter Mapping:
    Create a comprehensive comparison of conditions present in both settings:

    ParameterIn Vitro ValueIn Vivo EnvironmentPotential Impact
    pH7.2-7.45.0-6.5 (macrophage)Altered enzyme kinetics
    Mg2+1-2 mM0.01-0.1 mM (phagosome)Changed regulatory signals
    O2 levelAerobicMicroaerobic/anaerobicMetabolic differences
    Iron availabilityAbundantRestrictedStress response activation
  • Regulatory Network Analysis:

    • Compare transcriptomic profiles between conditions to identify differentially activated pathways

    • Construct regulatory network models incorporating condition-specific inputs

    • Identify compensatory mechanisms present in vivo but absent in vitro

  • Substrate Availability Assessment:

    • Quantify undecaprenyl phosphate pools in both contexts

    • Analyze lipid A structures from bacteria grown in vitro versus recovered from infection sites

    • Measure flux through the modification pathway using metabolic labeling

Interpretation Guidelines:

When faced with contradictory data, researchers should:

  • Consider whether the contradiction reveals a novel biological insight rather than experimental error

  • Develop testable hypotheses that could explain the discrepancy

  • Design hybrid experimental systems of increasing complexity to identify the transition point where behavior changes

  • Validate findings using multiple methodological approaches

This structured approach transforms apparent contradictions into opportunities for deeper understanding of context-dependent arnC function .

What approaches can be used to distinguish between direct and indirect effects of arnC mutations on antimicrobial resistance phenotypes?

Distinguishing direct from indirect effects requires multiple complementary approaches:

Genetic Dissection:

  • Site-directed mutagenesis targeting catalytic versus structural residues

  • Domain swapping with homologous enzymes from related species

  • Creation of point mutations that affect catalytic efficiency without disrupting protein-protein interactions

Biochemical Verification:

  • In vitro enzymatic assays with purified components to confirm direct catalytic activities

  • Mass spectrometry analysis of LPS modifications to quantify specific transfer activities

  • Analysis of enzymatic activity in membrane preparations versus purified systems

Systems Biology Approaches:
Comprehensive analysis to identify secondary effects:

  • Global Expression Analysis:
    RNA-seq comparisons between:

    • Wild-type strains

    • Catalytically inactive point mutants

    • Complete arnC deletion mutants

  • Metabolomic Profiling:
    Quantification of metabolites in central pathways affected by membrane alterations

  • Suppressor Mutation Analysis:
    Identification of second-site mutations that restore resistance in arnC mutant backgrounds

Temporal Analysis:
Examination of the sequence of cellular events following arnC mutation or inhibition:

TimepointDirect EffectsIndirect Effects
Immediate (0-30 min)Cessation of Ara4FN transferMinimal secondary changes
Short-term (1-3 h)Altered LPS compositionMembrane permeability changes
Long-term (>6 h)Complete LPS remodelingStress response activation, transcriptional reprogramming

This multi-faceted approach enables researchers to discriminate between primary effects directly linked to arnC function and secondary consequences arising from altered cell envelope properties .

How can researchers address inconsistent phenotypes observed in arnC mutant strains?

Inconsistent phenotypes in arnC mutant studies can be systematically resolved through the following troubleshooting protocol:

Genetic Verification:

  • Whole genome sequencing to identify potential compensatory mutations

  • PCR verification of deletion boundaries to confirm precise gene targeting

  • Expression analysis of adjacent genes to identify potential polar effects

  • Complementation with wild-type arnC to confirm phenotype restoration

Experimental Standardization:
Implement rigorous standardization of key variables:

VariableRecommendationImpact on Phenotype
Growth phaseHarvest at OD600 = 0.6-0.83-5 fold difference in MIC values
Media compositionDefined media with precise ion concentrationsUp to 8-fold variation in resistance
Inoculum size5 × 10^5 CFU/ml for MIC determination2-4 fold effect on apparent resistance
Incubation timeStandardized reading times (16-20h)Time-dependent phenotypes can vary

Environmental Controls:

  • Temperature control (±0.5°C) during all growth steps

  • pH verification before and after growth

  • Consistent oxygen availability (shaking speed, flask-to-medium ratio)

  • Protection from light for photosensitive components

Phenotypic Analysis Refinement:

  • Use multiple methods to assess resistance (broth microdilution, agar dilution, E-test)

  • Implement time-kill kinetics rather than endpoint MIC where appropriate

  • Quantify population heterogeneity through population analysis profiling

By implementing this systematic troubleshooting approach, researchers can identify sources of variability and establish reproducible phenotypic characterization of arnC mutants .

What strategies can overcome challenges in detecting and quantifying LPS modifications resulting from arnC activity?

Detecting and quantifying LPS modifications presents several technical challenges that can be addressed through specialized approaches:

Sample Preparation Optimization:

  • Gentle LPS extraction methods to preserve labile modifications

    • Use phenol-water extraction rather than harsh detergent methods

    • Avoid extended heating steps that can hydrolyze modifications

    • Include antioxidants to prevent degradation of sensitive groups

  • Enrichment strategies for modified species

    • HPLC fractionation before analysis

    • Solid-phase extraction to concentrate minor species

    • Selective precipitation methods based on charge differences

Analytical Method Selection:

MethodAdvantagesLimitationsBest Application
Mass Spectrometry (MS)High sensitivity, structural informationComplex spectra, requires standardsIdentification of novel modifications
NMR SpectroscopyDetailed structural characterizationRequires significant materialConfirmation of modification position
Chromatographic methodsQuantitative, comparativeLimited structural informationRelative abundance measurements
RadiolabelingHigh sensitivity, flux measurementsSafety concerns, specialized facilitiesBiosynthetic pathway studies

Quantification Strategies:

  • Isotope dilution with synthetic standards

  • Multiple reaction monitoring (MRM) for specific modifications

  • Relative quantification using consistent internal standards

  • Calibration curves with purified reference compounds

Visualization Approaches:
For gel-based analysis:

  • Silver staining optimization for modified LPS detection

  • Western blotting with modification-specific antibodies

  • Fluorescent labeling of specific functional groups

These methodological refinements enable reliable detection and quantification of the subtle LPS modifications catalyzed by arnC, allowing more precise correlation between enzymatic activity and phenotypic outcomes .

What methods can effectively distinguish between arnC-specific functions and compensatory mechanisms in antimicrobial resistance?

Differentiating arnC-specific functions from compensatory mechanisms requires strategic experimental approaches:

Genetic Manipulation Strategies:

  • Construction of multiple mutants targeting different resistance pathways:

    • ΔarnC single mutant

    • ΔpmrC (phosphoethanolamine transferase) single mutant

    • ΔarnC/ΔpmrC double mutant

    • Complemented strains for each

  • Inducible expression systems:

    • Place arnC under tight inducible control

    • Create graded expression levels

    • Monitor resistance phenotypes as function of expression

Temporal Analysis:
Study the adaptation process following arnC disruption:

  • Immediate consequences (0-2 hours post-disruption)

  • Short-term adaptation (6-24 hours)

  • Long-term compensation (multiple passages)

Comparative Genomics and Transcriptomics:

  • Whole genome sequencing of adapted strains to identify compensatory mutations

  • RNA-seq to identify upregulated alternative pathways

  • ChIP-seq to map regulatory changes in response to arnC deletion

Biochemical Verification:
Direct measurement of multiple LPS modifications:

ModificationMediating EnzymeDetection MethodExpected in ΔarnC
Ara4FNArnCMass spectrometryAbsent
PhosphoethanolaminePmrC31P NMR, MSPotentially increased
PalmitatePagPMS, fatty acid analysisOften upregulated
L-Ara4N at different positionsUnknown transferasesMS with fragmentationMay appear at alternative sites

Functional Discrimination:
Challenge mutants with compounds that differentiate between resistance mechanisms:

  • Polymyxin variants with different binding properties

  • Synthetic antimicrobial peptides with altered charge distributions

  • Compounds targeting specific steps in LPS modification pathways

This multi-faceted approach enables researchers to distinguish primary effects directly attributable to arnC function from secondary compensatory mechanisms that emerge in response to cell envelope stress .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.