Recombinant Salmonella enteritidis PT4 UPF0259 membrane protein yciC (yciC)

What is the structural composition of Recombinant Salmonella enteritidis PT4 UPF0259 membrane protein yciC?

The Recombinant Salmonella enteritidis PT4 UPF0259 membrane protein yciC is a full-length protein consisting of 247 amino acids. Its primary sequence is: MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGImLIVVPGIIMAIVLALAPVmLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYmLIRQ . Based on computational and experimental analyses, this protein likely contains multiple transmembrane domains that anchor it within the bacterial cell membrane, similar to other membrane proteins in this family.

What are the optimal storage and handling conditions for recombinant yciC protein?

For optimal stability and activity, recombinant yciC protein should be stored in Tris-based buffer with 50% glycerol at -20°C. For extended storage periods, conservation at -80°C is recommended . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to prevent protein degradation and loss of structural integrity. When handling the protein for experimental purposes, maintaining a cold chain and using appropriate protease inhibitors is advised to preserve native conformation and prevent degradation.

What are the recommended approaches for studying membrane protein insertion mechanisms of yciC?

Based on studies of similar membrane proteins like YidC, several methodological approaches are recommended for studying yciC insertion mechanisms:

• Co-translational insertion assays: Using ribosome nascent chain complexes (RNCs) with cryo-electron microscopy to visualize the protein during insertion.

• Evolutionary co-variation analysis: This computational approach can identify conserved residues and predict structural arrangements of transmembrane domains.

• Lipid-versus-protein-exposure experiments: These help determine which protein regions interact with the lipid bilayer versus other proteins.

• Molecular dynamics simulations: These can predict how the protein behaves within the membrane environment, including potential membrane thinning effects .

• Site-directed mutagenesis: Creating alanine mutants of key residues followed by functional complementation assays can validate the importance of specific amino acids in protein function.

The combined use of these techniques allows for comprehensive characterization of membrane protein insertion mechanisms.

How can researchers effectively express and purify recombinant yciC for structural studies?

For effective expression and purification of recombinant yciC:

Expression system selection:

• Bacterial systems (E. coli) using specialized strains designed for membrane protein expression

• Cell-free expression systems supplemented with lipids or detergents

Purification protocol:

• Cell lysis using appropriate detergents that maintain protein structure

• Affinity chromatography utilizing fusion tags determined during the production process

• Size exclusion chromatography for final purification

• Quality assessment using SDS-PAGE and Western blotting

Optimization parameters:

Successful purification should yield protein in sufficient quantities (>1 mg/mL) and purity (>95%) for downstream structural and functional analyses while maintaining native conformation.

What techniques are most suitable for analyzing the membrane topology of yciC?

To accurately analyze the membrane topology of yciC, researchers should employ multiple complementary approaches:

• Computational prediction tools: Use algorithms specifically designed for membrane protein topology prediction such as TMHMM, Phobius, and TOPCONS to generate initial models.

• Substituted cysteine accessibility method (SCAM): This experimental approach involves introducing cysteine residues at different positions and assessing their accessibility to membrane-impermeable thiol-reactive reagents.

• Protease protection assays: Using proteases to determine which regions are protected by the membrane versus exposed to either cytoplasmic or periplasmic space.

• Fluorescence and FRET techniques: These can provide dynamic information about protein conformation in the membrane.

• Cryo-electron microscopy: As demonstrated with similar proteins like YidC, this technique can resolve structural details when the protein is in complex with ribosomes .

A combined analysis comparing computational predictions with experimental data provides the most reliable topology model.

How does the lipid environment affect the function and dynamics of yciC protein?

The function and dynamics of membrane proteins like yciC are significantly influenced by their lipid environment. Studies of similar membrane proteins like YidC have shown that these proteins can induce thinning of the lipid bilayer by 7-10 Å due to hydrophobic mismatch between transmembrane helices and the membrane . This thinning effect is particularly pronounced in regions near specific transmembrane helices and may be functionally relevant for membrane protein insertion mechanisms.

The distribution of hydrophilic and hydrophobic residues within membrane proteins creates distinct environments that facilitate protein-lipid interactions. In proteins similar to yciC, a hydrophilic environment on the cytoplasmic side of the transmembrane bundle continues into a hydrophobic cluster of aromatic residues toward the periplasmic side . This arrangement may:

• Create specialized microenvironments that facilitate insertion of substrate proteins

• Reduce the energetic barrier for translocation of polar regions across the membrane

• Stabilize the protein through specific lipid-protein interactions

For experimental investigation of lipid effects on yciC, researchers should consider:

• Reconstitution in different lipid compositions to assess functional changes

• Molecular dynamics simulations to predict lipid-protein interactions

• Fluorescence-based techniques to measure conformational changes in different lipid environments

What is the role of yciC in bacterial pathogenesis and immune response?

While specific information about yciC's role in pathogenesis is limited in the provided research, studies on Salmonella enteritidis PT4 membrane proteins provide important context. Immunization studies in mice using formalin-killed S. enteritidis PT4 have shown that membrane proteins can elicit protective immune responses . BALB/c mice immunized with S. enteritidis PT4 antigens develop IgG antibodies against outer membrane proteins, including OmpA and a 31 kDa minor outer membrane protein .

To investigate yciC's specific role in pathogenesis, researchers should consider:

• Knockout studies: Creating yciC deletion mutants and assessing changes in virulence in appropriate animal models

• Immune response analysis: Determining whether yciC elicits antibody responses during infection or immunization

• Host-pathogen interaction studies: Investigating whether yciC interacts with specific host cell components

• Comparative virulence analysis: Testing different mouse strains (BALB/c, Schofield, B10D2, Biozzi, C3HeJ, B10ITYR, C57/L) for susceptibility to wild-type versus yciC mutant strains

Understanding yciC's potential role in pathogenesis could provide insights into new therapeutic or vaccine development strategies.

How do mutations in key residues affect the structural stability and function of yciC?

Based on studies of related membrane proteins, mutations in key residues can have profound effects on stability and function. Research on YidC has shown that certain highly conserved residues (such as T362 in TM2 and Y517 in TM6) completely inactivate the protein when mutated to alanine, while mutations in other residues (F433, M471, and F505) show intermediate activity levels .

For investigating yciC's key residues:

• Identify conserved motifs: Through sequence alignment of yciC homologs across bacterial species

• Target specific residue types:

  • Charged residues in transmembrane segments

  • Aromatic residues at membrane interfaces

  • Residues predicted to participate in inter-helical interactions

• Perform site-directed mutagenesis: Create alanine substitutions or more conservative mutations

• Functional analysis:

  • In vivo complementation assays in yciC knockout strains

  • Membrane stability assessments

  • Protein-protein interaction studies

• Structural impact analysis:

  • Circular dichroism spectroscopy to assess secondary structure changes

  • Thermal stability assays to measure protein stability

Correlating structural changes with functional outcomes would provide valuable insights into structure-function relationships of yciC.

How can structural insights from yciC research inform the development of novel antimicrobials?

Membrane proteins represent attractive targets for antimicrobial development due to their essential roles and accessibility. Structural insights from yciC research could inform antimicrobial development through several avenues:

• Target-based drug design: If yciC proves essential for bacterial viability or virulence, its unique structural features could be targeted by small molecule inhibitors.

• Membrane disruption strategies: Understanding how yciC interacts with and potentially modifies the membrane environment could reveal vulnerabilities in membrane organization that could be exploited.

• Protein-protein interaction inhibition: If yciC participates in critical protein complexes, disrupting these interactions could impair bacterial fitness.

• Cross-species conservation analysis: Comparing yciC structure with mammalian membrane proteins could identify bacterial-specific features suitable for selective targeting.

Researchers should establish:

• The essentiality of yciC for S. enteritidis survival

• High-resolution structural data

• Binding sites for potential small molecules

• Cross-species conservation patterns

This information would provide a foundation for structure-based antimicrobial development strategies.

What are the current technical challenges in determining the high-resolution structure of yciC?

Membrane proteins like yciC present significant challenges for high-resolution structural determination. Based on experiences with similar membrane proteins, researchers face several key obstacles:

• Protein expression and purification:

  • Achieving sufficient yields of properly folded protein

  • Maintaining stability during purification

  • Selecting appropriate detergents that mimic the native membrane environment

• Crystallization difficulties:

  • Limited polar surfaces for crystal contacts

  • Detergent micelle interference with crystal packing

  • Conformational heterogeneity

• Cryo-EM challenges:

  • Small size of individual proteins (yciC is approximately 25-30 kDa)

  • Contrast limitations in detergent environments

  • Potential flexibility in certain protein regions

• NMR spectroscopy limitations:

  • Size constraints for solution NMR

  • Complex spectral overlap

  • Detergent interference with spectral quality

Recent advances that may help overcome these challenges include:

• Lipid cubic phase crystallization

• Nanodiscs and saposin-lipoprotein nanoparticles for native-like environments

• Cryo-EM direct electron detectors and improved image processing

• Fusion protein strategies to increase size and stability

How does yciC compare functionally with homologous proteins in other bacterial pathogens?

Comparative analysis of yciC with homologous proteins in other bacterial pathogens can provide evolutionary and functional insights. Researchers should consider:

• Sequence conservation analysis:

  • Identify core conserved residues across bacterial species

  • Map conservation patterns onto predicted structural models

  • Correlate conservation with known functional domains

• Phylogenetic distribution:

  • Determine presence/absence patterns across bacterial taxa

  • Identify lineage-specific adaptations

  • Correlate with pathogenesis mechanisms

• Functional complementation studies:

  • Test whether yciC homologs from other species can complement S. enteritidis yciC mutants

  • Identify species-specific functional requirements

• Comparative structural biology:

  • Compare predicted or determined structures across species

  • Identify structural innovations unique to specific pathogens

This comparative approach would reveal whether yciC represents a conserved bacterial mechanism or has evolved specialized functions in S. enteritidis PT4, informing both basic understanding and potential broad-spectrum therapeutic strategies.

What are common pitfalls in immunological studies involving yciC and how can they be addressed?

Immunological studies involving bacterial membrane proteins like yciC face several technical challenges:

• Cross-reactivity issues:

  • Problem: Antibodies may cross-react with structurally similar proteins

  • Solution: Validate antibody specificity using knockout strains and purified recombinant proteins

• Conformational epitope preservation:

  • Problem: Denaturation during sample preparation may destroy conformational epitopes

  • Solution: Use native PAGE, dot blots, and mild solubilization conditions

• Background in immunized animals:

  • Problem: Pre-existing antibodies to related proteins

  • Solution: Careful selection of mouse strains; use of BALB/c mice which show clear immunological responses to S. enteritidis PT4 antigens

• Accessibility in intact bacteria:

  • Problem: Membrane proteins may have limited exposed epitopes

  • Solution: Use multiple detection methods including flow cytometry and immunofluorescence microscopy

• Reproducibility challenges:

  • Problem: Variation in immunization protocols

  • Solution: Standardize immunization schedules, antigen preparation, and adjuvant selection

Researchers should implement proper controls, including:

• Pre-immune sera comparison

• Isotype controls

• Absorption controls with related antigens

• Western blots to confirm antibody specificity

How can researchers differentiate between direct and indirect effects when studying yciC function?

Differentiating between direct and indirect effects is a significant challenge when studying membrane protein function. For yciC research, consider these approaches:

• Genetic complementation strategies:

  • Use point mutations rather than complete gene deletions

  • Develop conditional expression systems

  • Employ complementation with homologs to identify critical domains

• Time-resolved experiments:

  • Utilize rapid induction or inhibition systems

  • Monitor phenotypic changes over multiple time points

  • Identify primary versus secondary effects based on temporal sequence

• Interaction partner identification:

  • Chemical crosslinking coupled with mass spectrometry

  • Bacterial two-hybrid or split-GFP systems adapted for membrane proteins

  • Proximity labeling approaches (BioID, APEX) to identify neighborhood proteins

• Direct biochemical assays:

  • Develop in vitro reconstitution systems with purified components

  • Use liposome-based functional assays

  • Create chimeric proteins to map functional domains

• Systematic control experiments:

  • Multiple knockout/knockdown controls

  • Secondary site suppressors

  • Complementation with non-functional mutants

This multi-faceted approach helps distinguish direct functional roles from secondary effects resulting from disruption of membrane integrity or downstream processes.