Recombinant Salmonella enteritidis PT4 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella enteritidis PT4 UPF0283 Membrane Protein YcjF (YcjF)

Salmonella enteritidis PT4 UPF0283 membrane protein YcjF (YcjF) is a protein found in the bacterium Salmonella enteritidis PT4 . YcjF is also referred to as UPF0283 membrane protein YcjF and SEN1349 . It is a full-length protein consisting of 353 amino acids .

Characteristics

CharacteristicDescription
Gene NameycjF
SynonymsycjF; SEN1349; UPF0283 membrane protein YcjF
UniProt IDB5R4A8
SpeciesSalmonella enteritidis PT4 (strain P125109)
Protein LengthFull Length (1-353aa)
AA SequenceMSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAALRPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVVTEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHETQNDREIVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSSLALVDMAFIAWRNLRLINRIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIGAGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Molecular WeightApproximately 39.1 kDa
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
TagHis
Expression Region1-353

Production and Sourcing

Recombinant YcjF protein is produced in E. coli . The protein is fused to an N-terminal His tag to facilitate purification . After purification, the protein is typically lyophilized into powder form .

Function and Significance

The YcjF protein is a membrane protein of unknown function (UPF0283) . Research indicates membrane and surface structures are important to Salmonella enteritidis PT4 . Studies suggest that Salmonella desiccation resistance genes are mostly related to cell wall/membrane/envelope biogenesis .

Applications

Recombinant Salmonella enteritidis PT4 UPF0283 membrane protein YcjF (YcjF) is useful in a variety of applications:

  • ELISA assays

  • Western blotting

  • Vaccine development

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ycjF; SEN1349; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSSLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links

KEGG: set:SEN1349

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is the ycjF protein across different Salmonella strains and serovars?

The UPF0283 membrane protein ycjF shows significant conservation across Salmonella serovars. Comparative analysis of the amino acid sequences from Salmonella enteritidis PT4 (UniProt: B5R4A8), Salmonella typhimurium (UniProt: Q8ZP64), Salmonella paratyphi A (UniProt: B5BJ45), and Salmonella enterica subsp. arizonae (UniProt: A9MQ55) reveals high sequence similarity with only minor variations .

Notable differences include:

  • Position 109: Salmonella enteritidis PT4 and S. typhimurium contain isoleucine (I), while S. paratyphi A contains valine (V)

  • Position 199: S. enteritidis PT4 contains alanine (A), while S. typhimurium and S. paratyphi A contain asparagine (N)

  • Position 217: S. enteritidis PT4 contains serine (S), while S. paratyphi A contains proline (P)

These conservation patterns suggest functional importance of the protein across the Salmonella genus, although the precise function remains to be fully characterized.

What are the optimal expression and purification conditions for recombinant Salmonella enteritidis PT4 ycjF protein?

Based on established protocols for recombinant Salmonella enteritidis PT4 ycjF protein production:

Expression System:

  • E. coli is the preferred heterologous expression system

  • Expression constructs typically include N-terminal His tags for purification

  • Full-length protein (amino acids 1-353) is expressed

Purification Protocol:

  • Lyse bacterial cells in Tris/PBS-based buffer (pH 8.0)

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Concentrate and store in Tris-based buffer with 50% glycerol

  • For long-term storage, aliquot and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this compromises protein integrity

Reconstitution Recommendations:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • For working aliquots, store at 4°C for up to one week

How can researchers effectively use C. elegans as a model system to evaluate the role of ycjF in Salmonella virulence?

The C. elegans survival assay provides a valuable preliminary screening method for assessing Salmonella virulence factors, including potential roles of proteins like ycjF. The protocol based on established methodology is as follows:

C. elegans Preparation:

  • Wash C. elegans strain SS104 from food plates with 10 ml M9 buffer

  • Synchronize with 12% bleach and 1M NaOH

  • Incubate eggs overnight at 20°C in M9 buffer with shaking

  • Seed resulting L1 larvae on fresh food plates and incubate at 25°C for 48h

Experimental Setup:

  • Pick 15 L4 larvae individually and transfer to NGM plates colonized with the bacterial strain of interest (wild-type vs. ycjF mutant)

  • Include E. coli OP50 as a control

  • Incubate all test plates at 25°C to prevent reproduction of thermo-sterile C. elegans strain

  • Count survival daily by gently poking worms with a picker to observe touch response

Data Analysis:

  • Perform at least three biological and three technical replicates (total of 9 experiments, 135 worms per test strain)

  • Use Kaplan-Meier survival analysis to determine differences in longevity

  • Compare virulence potential between wild-type and ycjF-mutant strains

It's important to note that while C. elegans assays are valuable for preliminary screening, they have limitations in reflecting mammalian infection. The results should be used for pre-screening bacterial strains to select candidates for further animal experiments, not as a complete replacement for them .

What is the potential role of ycjF in Salmonella enteritidis PT4 virulence and pathogenesis?

While the specific function of ycjF in Salmonella pathogenesis remains incompletely characterized, several lines of evidence suggest potential roles in virulence:

  • Membrane Localization: As a membrane protein, ycjF may participate in host-pathogen interactions, potentially mediating adherence or invasion .

  • Conservation: The high conservation of ycjF across Salmonella serovars suggests functional importance. Comparative genomic analysis shows that ycjF is maintained in pathogenic Salmonella strains that have undergone substantial genome reduction, indicating selective retention .

  • Genetic Context: Microarray analysis of the Salmonella PreA/PreB (QseB/QseC) regulon, which is important for virulence, has identified genes potentially co-regulated with ycjF, suggesting a possible role in coordinated virulence expression .

  • Phenotypic Evidence: Studies examining differences in virulence between Salmonella enteritidis PT4 strains have shown that variation in membrane proteins can contribute to differential virulence. While not specifically implicating ycjF, these studies provide a framework for understanding how membrane proteins affect pathogenicity .

To definitively establish the role of ycjF in virulence, researchers should consider:

  • Creating ycjF knockout mutants and complemented strains

  • Performing comparative invasion assays in epithelial cell lines

  • Conducting competition assays between wild-type and mutant strains in animal models

  • Transcriptomic analysis to identify co-regulated genes during infection

How does ycjF expression change during different phases of Salmonella infection?

Experimental Approach:

  • In vitro infection models:

    • Infect epithelial cell lines (e.g., HeLa) at MOI of 100

    • Collect samples at various timepoints (e.g., 30 min, 1h, 2h, 4h, 8h, 24h post-infection)

    • Extract RNA from intracellular bacteria

    • Quantify ycjF expression using qRT-PCR or RNA-seq

  • In vivo infection models:

    • Infect BALB/c mice with 10^6 bacteria by oral gavage

    • Collect tissue samples (intestine, liver, spleen) at various timepoints

    • Extract RNA and quantify ycjF expression

    • Compare expression across tissues and timepoints

  • Environmental stress conditions:

    • Expose Salmonella cultures to conditions mimicking host environments:

      • Acidic pH (gastric environment)

      • Bile salts (intestinal environment)

      • Nutrient limitation

      • Oxidative stress

    • Monitor ycjF expression changes under these conditions

The genomic analysis of Salmonella strains recovered from stool samples of patients with gastroenteritis provides valuable methodological insights for studying gene expression in clinical isolates .

How does the genetic diversity of Salmonella enteritidis PT4 UPF0283 membrane protein ycjF compare across clinical isolates?

Recent research on genomic diversity of non-typhoidal Salmonella provides a framework for analyzing ycjF variation across clinical isolates. When examining multiple isolates from individual patients with gastroenteritis, researchers have observed:

  • Within-host diversity: Single patients can harbor multiple genetic variants of Salmonella, potentially including variations in membrane proteins like ycjF .

  • Methodology for comparative genomics of clinical isolates:

    • Collect multiple single-colony isolates (up to 20) from each patient

    • Perform whole genome sequencing using hybrid sequencing technologies (short-read and long-read)

    • Identify SNPs and structural variations

    • Generate phylogenetic analyses to examine relationships between isolates

The specific diversity of ycjF has not been comprehensively characterized across clinical isolates, but the approaches used in recent genomic studies of patient samples provide an excellent methodological template for such investigation.

What evolutionary pressures might be acting on the ycjF gene in Salmonella enteritidis PT4?

To assess evolutionary pressures on the ycjF gene, researchers should:

  • Calculate dN/dS ratios:

    • Collect ycjF sequences from diverse Salmonella strains

    • Calculate the ratio of non-synonymous (dN) to synonymous (dS) substitutions

    • Ratios < 1 suggest purifying selection (conservation)

    • Ratios > 1 suggest positive selection (adaptation)

  • Analyze selective pressure across protein domains:

    • Map conservation scores onto the protein structure

    • Identify regions under different selective pressures

    • Connect to functional domains if known

  • Compare with related enterobacteria:

    • Extend analysis to ycjF homologs in Escherichia, Shigella, and other enterobacteria

    • Identify lineage-specific selection patterns

  • Examine horizontal gene transfer potential:

    • Analyze GC content and codon usage bias

    • Check for insertion sequences or phage-associated elements nearby

    • Determine if ycjF shows evidence of horizontal acquisition or if it's part of the core genome

The high conservation of ycjF across Salmonella strains suggests it likely experiences purifying selection, indicating functional importance .

What methodologies are most appropriate for investigating potential interaction partners of ycjF in Salmonella enteritidis PT4?

To identify potential interaction partners of ycjF, researchers should consider these complementary approaches:

Protein-Protein Interaction Methods:

  • Bacterial Two-Hybrid (B2H) System:

    • Clone ycjF into bait vector

    • Screen against genomic library of Salmonella prey constructs

    • Verify interactions using co-immunoprecipitation

  • Pull-down Assays with Recombinant His-tagged ycjF:

    • Express and purify His-tagged ycjF

    • Incubate with Salmonella cell lysates

    • Capture complexes using Ni-NTA resin

    • Identify binding partners using mass spectrometry

  • Cross-linking Mass Spectrometry (XL-MS):

    • Treat live Salmonella cells with membrane-permeable crosslinkers

    • Lyse cells and purify ycjF with crosslinked partners

    • Digest and analyze by mass spectrometry

    • Map interaction sites to the protein structure

  • Proximity-dependent Biotin Identification (BioID):

    • Generate fusion protein of ycjF with BioID ligase

    • Express in Salmonella

    • Identify biotinylated proximity partners

    • Validate with reciprocal tagging

Once interaction partners are identified, they should be validated using independent methods and functionally characterized through genetic approaches.

How can researchers effectively design experiments to determine if ycjF contributes to antimicrobial resistance in Salmonella enteritidis PT4?

To investigate ycjF's potential role in antimicrobial resistance (AMR), researchers should implement the following experimental design:

Genetic Manipulation:

  • Generate ycjF deletion mutant (ΔycjF) in Salmonella enteritidis PT4

  • Create complemented strain (ΔycjF + ycjF)

  • Develop overexpression strain (PT4-ycjF+)

Phenotypic Characterization:

  • Minimum Inhibitory Concentration (MIC) Testing:

    • Test parent strain, ΔycjF, complemented strain, and overexpression strain

    • Include diverse antimicrobial classes (β-lactams, aminoglycosides, fluoroquinolones, etc.)

    • Use standard CLSI broth microdilution methods

  • Antimicrobial Killing Kinetics:

    • Expose strains to sub-MIC and MIC concentrations

    • Sample at intervals for viable count determination

    • Calculate killing rates for each strain

  • Membrane Permeability Assays:

    • Use fluorescent dyes (e.g., propidium iodide, NPN)

    • Measure dye uptake in presence/absence of ycjF

    • Correlate with antimicrobial susceptibility

Molecular Mechanisms:

  • Gene Expression Analysis:

    • Compare transcriptomes of wild-type and ΔycjF under antimicrobial stress

    • Focus on known AMR genes (efflux pumps, porins)

    • Validate with qRT-PCR

  • Efflux Activity:

    • Use fluorescent substrates (e.g., ethidium bromide, Nile red)

    • Measure accumulation/efflux in presence/absence of ycjF

    • Include efflux inhibitors as controls

Current research has identified multidrug efflux pump genes (mdsA and mdsB) in Salmonella isolates, providing context for understanding membrane protein contributions to AMR .

What are the common challenges researchers face when working with recombinant membrane proteins like ycjF, and how can these be addressed?

Researchers working with recombinant membrane proteins like ycjF frequently encounter several technical challenges:

1. Expression and Solubility Issues:

  • Challenge: Low expression levels and inclusion body formation

  • Solutions:

    • Use specialized E. coli strains (C41, C43, Lemo21)

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Try fusion partners (MBP, SUMO, Mistic)

    • Consider eukaryotic expression systems for complex membrane proteins

2. Purification Difficulties:

  • Challenge: Detergent selection and membrane protein destabilization

  • Solutions:

    • Screen multiple detergents (DDM, LDAO, FC-12)

    • Include lipids during purification

    • Use styrene maleic acid copolymers (SMALPs)

    • Maintain glycerol (20-50%) in buffers

    • Avoid repeated freeze-thaw cycles

3. Structural Instability:

  • Challenge: Protein denaturation and aggregation during storage

  • Solutions:

    • Store at -80°C in small aliquots

    • Add stabilizing agents (trehalose, glycerol)

    • Maintain pH 7.5-8.0

    • Consider nanodiscs for long-term stability

4. Functional Characterization:

  • Challenge: Establishing native-like activity in vitro

  • Solutions:

    • Reconstitute in liposomes

    • Perform activity assays with appropriate substrates

    • Compare with native membrane preparations

    • Use complementation assays to verify function

For ycjF specifically, the recombinant protein has been successfully produced with N-terminal His tags and stored in Tris-based buffer with 50% glycerol, with recommendations to avoid repeated freeze-thaw cycles .

How can researchers accurately assess the membrane topology and subcellular localization of ycjF in Salmonella enteritidis PT4?

To determine the membrane topology and subcellular localization of ycjF, researchers should employ complementary approaches:

Computational Prediction:

  • Use membrane protein topology prediction algorithms:

    • TMHMM, Phobius, TOPCONS

    • Predict transmembrane segments and orientation

    • Identify potential signal sequences

Experimental Verification:

  • Reporter Fusion Approach:

    • Generate C-terminal and N-terminal fusions with reporters:

      • PhoA (active in periplasm)

      • GFP (active in cytoplasm)

    • Create truncated fusions at predicted loop regions

    • Compare activity patterns to map topology

  • Cysteine Scanning Mutagenesis:

    • Replace residues with cysteine sequentially

    • Treat intact cells with membrane-impermeable sulfhydryl reagents

    • Determine accessibility of each position

    • Map protected vs. exposed regions

  • Protease Protection Assays:

    • Generate epitope-tagged versions of ycjF

    • Prepare spheroplasts and right-side-out vesicles

    • Treat with proteases with/without membrane permeabilization

    • Detect protected fragments by immunoblotting

  • Subcellular Fractionation:

    • Separate cellular compartments:

      • Cytoplasm

      • Inner membrane

      • Periplasm

      • Outer membrane

    • Detect ycjF using specific antibodies

    • Verify purity with compartment-specific markers

  • Fluorescence Microscopy:

    • Create ycjF-fluorescent protein fusions

    • Visualize localization in live cells

    • Co-localize with known membrane markers

    • Perform time-lapse imaging during infection

Combining these approaches provides robust evidence for the topology and localization of membrane proteins like ycjF, which is essential for understanding their function in bacterial physiology and virulence.

How effective is recombinant ycjF as an antigen for developing serological assays to detect Salmonella enteritidis PT4 infection?

The potential of recombinant ycjF as a serological marker for S. enteritidis PT4 infection requires systematic evaluation:

Antigen Preparation:

  • Express and purify recombinant His-tagged ycjF protein using established protocols

  • Assess purity by SDS-PAGE (>90% purity recommended)

  • Verify proper folding through circular dichroism or limited proteolysis

Antibody Production and Characterization:

  • Immunize animal models with purified recombinant ycjF

  • Harvest and purify polyclonal antibodies

  • Perform Western blot against:

    • Recombinant ycjF

    • Whole cell lysates of various Salmonella strains

    • Non-Salmonella enterobacteria (specificity control)

  • Determine sensitivity and cross-reactivity profiles

Serological Assay Development:

  • ELISA Development:

    • Coat plates with purified recombinant ycjF

    • Test sera from:

      • Confirmed S. enteritidis PT4 infections

      • Other Salmonella infections

      • Non-Salmonella infections

      • Healthy controls

    • Calculate sensitivity, specificity, positive and negative predictive values

  • Evaluation Metrics:

    • Determine if anti-ycjF antibodies correlate with infection status

    • Establish if antibody levels can distinguish between:

      • Active vs. resolved infections

      • S. enteritidis PT4 vs. other Salmonella serovars

    • Compare with established serological markers

The high conservation of ycjF across Salmonella serovars may limit its utility for distinguishing specific serovars, but may still be valuable for general Salmonella detection.

Can ycjF be used as a component in subunit vaccine development against Salmonella enteritidis PT4?

Evaluating ycjF as a potential vaccine candidate requires systematic assessment:

Antigenicity and Immunogenicity Assessment:

  • Identify potential B-cell and T-cell epitopes using computational prediction

  • Express recombinant ycjF segments containing predicted epitopes

  • Evaluate immunogenicity in animal models:

    • Antibody responses (IgG, IgA titers)

    • T-cell responses (cytokine profiles, proliferation assays)

    • Mucosal immune responses

Vaccine Formulation Studies:

  • Adjuvant Selection:

    • Test various adjuvants (aluminum salts, oil-in-water emulsions, TLR agonists)

    • Measure impact on immunogenicity and safety profiles

  • Delivery Systems:

    • Evaluate different formats:

      • Recombinant protein with adjuvants

      • DNA vaccines encoding ycjF

      • Viral vector vaccines expressing ycjF

      • Nanoparticle-based delivery

Protection Studies:

  • Challenge Models:

    • Vaccinate animals with optimized ycjF formulation

    • Challenge with virulent S. enteritidis PT4 strains

    • Compare with established vaccine strains

    • Measure:

      • Protection against colonization

      • Reduction in bacterial shedding

      • Prevention of systemic spread

      • Survival rates

  • Comparative Analysis:

    • Compare protection conferred by ycjF with:

      • Whole-cell killed vaccines

      • Live attenuated vaccines

      • Other subunit vaccines

Research has shown that commercial egg-type lines can have different susceptibilities to S. enteritidis PT4 infection, with line L2 being particularly susceptible (13.8% SE-positive yolks) . These differential susceptibilities provide a framework for testing vaccine efficacy in poultry models.

What novel experimental approaches are being developed to understand the role of ycjF in bacterial membrane biology?

Cutting-edge approaches to investigate membrane proteins like ycjF include:

Advanced Imaging Techniques:

  • Super-resolution Microscopy:

    • Visualize ycjF distribution in bacterial membranes at nanoscale resolution

    • Track dynamic changes during environmental stress or infection

    • Combine with multicolor imaging to study colocalization with other proteins

  • Cryo-Electron Microscopy:

    • Determine high-resolution structures of ycjF in native membrane environments

    • Visualize interaction complexes

    • Compare with AlphaFold predictions

Functional Genomics Approaches:

  • CRISPR Interference (CRISPRi):

    • Create tunable knockdowns of ycjF

    • Study effects of partial depletion on membrane properties

    • Identify synthetic lethal interactions

  • Transposon Sequencing (Tn-Seq):

    • Identify genetic interactions between ycjF and other genes

    • Screen for conditions where ycjF becomes essential

    • Map functional relationships in membrane biology pathways

Biophysical Characterization:

  • Native Mass Spectrometry:

    • Analyze ycjF in intact membrane complexes

    • Determine oligomeric state and binding partners

    • Study lipid interactions

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map structural dynamics of ycjF

    • Identify regions involved in conformational changes

    • Study effects of environmental conditions on protein structure

Synthetic Biology Approaches:

  • Minimal Cell Systems:

    • Reconstitute ycjF in synthetic membranes

    • Determine minimal functional units

    • Engineer novel functions based on structural insights

These emerging approaches provide opportunities to understand ycjF function beyond traditional genetic and biochemical methods.

How might antimicrobial resistance mechanisms interact with ycjF function in Salmonella enteritidis PT4?

Exploring the intersection between ycjF and antimicrobial resistance requires multifaceted investigation:

Genetic Interaction Studies:

  • Double Mutant Analysis:

    • Generate ycjF deletion in combination with known AMR determinants:

      • Efflux pump components (AcrAB, TolC)

      • Porins (OmpF, OmpC)

      • Regulatory genes (MarR, SoxR)

    • Assess epistatic relationships

    • Measure changes in resistance profiles

  • Suppressor Screens:

    • Select for suppressors of ycjF-associated phenotypes

    • Identify genes that functionally interact with ycjF

    • Map pathways connecting ycjF to membrane permeability

Membrane Physiology:

  • Membrane Potential and Proton Motive Force:

    • Measure impact of ycjF deletion on membrane potential

    • Assess proton motive force maintenance

    • Connect to resistance mechanisms dependent on energized membranes

  • Lipidomic Analysis:

    • Compare membrane lipid composition in wild-type and ΔycjF strains

    • Identify changes in lipid profiles that might affect drug permeability

    • Correlate with antimicrobial susceptibility patterns

Transporter Function:

  • Drug Accumulation Studies:

    • Measure uptake and efflux of fluorescent antimicrobial surrogates

    • Compare kinetics between wild-type and ycjF mutants

    • Determine if ycjF affects existing transport systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.