Recombinant Salmonella enteritidis PT4 UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Functional and Research Context

The yjjB protein belongs to the UPF0442 family, classified as a hypothetical protein due to limited functional data. Key insights include:

  • Genomic Context: Identified in Salmonella enteritidis PT4 (strain P125109) and other Salmonella serovars, such as S. gallinarum and S. paratyphi A .

  • Pathogenicity Links: While not directly implicated in virulence, comparative proteomic studies highlight differences in S. enteritidis vs. S. typhimurium, suggesting potential roles in strain-specific pathogenicity .

  • Hypothetical Functions: Sequence homology suggests possible involvement in membrane-associated processes, though experimental validation is lacking .

Serological Assays and ELISA Kits

This protein is utilized in enzyme-linked immunosorbent assays (ELISA) to detect anti-Salmonella antibodies. Commercial ELISA kits (e.g., CSB-CF475183SWO) employ the recombinant yjjB protein as a target antigen .

Vaccine Development

While not directly used in vaccines, recombinant proteins like yjjB are critical for studying Salmonella antigenicity. For example, subunit vaccines targeting other Salmonella antigens (e.g., SseB) have shown efficacy, providing a framework for future applications .

Pathogenicity Studies

The protein’s role in Salmonella pathogenesis remains under investigation. Its presence in multiple Salmonella strains suggests conserved functions, but further studies are needed to elucidate its biological significance .

Research Gaps and Future Directions

Despite its availability as a recombinant product, the yjjB protein’s functional role in Salmonella biology is poorly understood. Priorities include:

  • Functional Characterization: Investigating interactions with host cells or other bacterial proteins.

  • Comparative Genomics: Exploring yjjB’s conservation across Salmonella serovars to infer evolutionary significance.

  • Structural Analysis: Crystallization or NMR studies to map its 3D structure and binding sites.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
yjjB; SEN4310; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: set:SEN4310

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does recombinant yjjB protein expression differ between expression systems?

The expression of recombinant yjjB protein can be achieved through various expression systems, each with distinct advantages and limitations for research applications:

Expression SystemAdvantagesLimitationsTypical YieldApplications
E. coliHigh yield, rapid growth, cost-effective, scalableLimited post-translational modifications, potential endotoxin contamination5-50 mg/LStructural studies, antibody production
YeastEukaryotic post-translational modifications, secreted proteinLonger cultivation time, complex media requirements1-10 mg/LFunctional assays
BaculovirusComplex protein folding, higher-order assembliesTechnically demanding, costlier1-5 mg/LProtein-protein interaction studies
Mammalian CellNative-like modifications, proper foldingLowest yield, highest cost0.1-1 mg/LImmunological studies

The choice of expression system should be guided by the specific research objectives. For basic characterization studies, E. coli systems are often preferred due to their higher yield and simpler protocols .

What are the optimal experimental design approaches for studying the immunogenicity of recombinant yjjB protein?

When designing experiments to evaluate the immunogenicity of recombinant yjjB protein, researchers should implement single-subject experimental designs (SSEDs) or randomized controlled trials depending on the research question .

For optimal experimental design:

  • Define measurable dependent variables: Antibody titers, cytokine profiles, lymphocyte proliferation responses, and protection efficacy against challenge should be quantitatively measured .

  • Establish proper controls: Include adjuvant-only groups, vector-only groups, and unrelated protein controls to distinguish specific immune responses .

  • Determine appropriate phase lengths: Collect at least 5 data points per experimental phase to establish reliable baselines and intervention effects .

  • Implement replication strategies: Use multiple subjects and replicate key experiments to demonstrate reproducibility of effects .

  • Address experimental uncertainty: Perform multiple trials with varying conditions (e.g., dose ranges, adjuvant combinations) to reduce uncertainty 9.

Researchers should compare the recombinant yjjB-induced immune response with that of other Salmonella antigens (such as FliC) to determine relative immunogenicity .

What purification strategies yield the highest purity and activity for recombinant yjjB protein?

The purification of recombinant yjjB requires a strategic approach due to its transmembrane nature:

  • Initial extraction: For membrane proteins like yjjB, use gentle detergents (DDM, LDAO, or OG) for solubilization while maintaining native conformation .

  • Affinity chromatography: Utilizing His-tag affinity purification is highly effective, with N-terminal 10xHis-tagged constructs showing good results for yjjB. Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin under native conditions typically achieves 85-90% purity .

  • Size exclusion chromatography: Further purification by SEC separates protein aggregates and improves homogeneity. Use buffers containing 0.05-0.1% detergent to maintain solubility .

  • Ion exchange chromatography: For highest purity (>95%), an additional ion exchange step can remove remaining contaminants .

  • Quality control assessments:

    • SDS-PAGE analysis (should show single band at ~17 kDa for untagged yjjB, ~24 kDa for His-tagged yjjB)

    • Western blotting with anti-Salmonella antisera confirms immunoreactivity

    • Mass spectrometry for sequence verification

    • Circular dichroism to assess proper folding

Purified protein should be stored at -20°C or -80°C, with glycerol (50%) to prevent freeze-thaw damage. Working aliquots can be stored at 4°C for up to one week .

How can recombinant yjjB protein be utilized in Salmonella vaccine development?

The development of subunit vaccines using recombinant Salmonella proteins offers significant advantages for targeted protection. For yjjB-based vaccine development, researchers should consider:

  • Antigen formulation:

    • Combine purified ryjjB with appropriate adjuvants (aluminum hydroxide, MF59, or simvastatin) to enhance immunogenicity

    • Test different doses (typically 10-50 μg per immunization) to determine optimal immune response

    • Consider fusion proteins with immunogenic carriers or adjuvanting molecules

  • Immunization protocols:

    • Primary vaccination followed by 1-2 booster doses at 2-3 week intervals

    • Multiple administration routes should be compared (subcutaneous, intramuscular, intranasal)

    • Document antibody titers, splenic lymphocyte proliferation, and protection efficacy

  • Efficacy evaluation:

    • Challenge studies with virulent Salmonella Enteritidis (typically 10^6 CFU)

    • Monitor survival rates, bacterial colonization in organs (liver, spleen)

    • Quantify bacterial clearance rates compared to control groups

Similar approaches with other Salmonella antigens have shown promising results. For example, rHis-SseB adjuvanted with simvastatin demonstrated 60% protection in mouse models against lethal Salmonella challenge, with significant reduction in bacterial loads in liver and spleen .

What methods are most effective for analyzing protein-protein interactions involving yjjB protein?

To characterize protein-protein interactions of yjjB, researchers should employ multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged yjjB in bacterial systems

    • Solubilize membrane fractions with mild detergents

    • Use tag-specific antibodies for pulldown

    • Analyze interacting partners by mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified yjjB on sensor chips

    • Flow potential interacting proteins over the surface

    • Measure association/dissociation kinetics

    • Calculate binding affinities (KD values)

  • Crosslinking mass spectrometry:

    • Use membrane-permeable crosslinkers (DSS, BS3)

    • Identify crosslinked peptides by LC-MS/MS

    • Determine interaction interfaces and protein proximity

  • Bacterial two-hybrid systems:

    • Modified for membrane proteins using split-ubiquitin approaches

    • Screen genomic libraries for potential interaction partners

    • Validate with targeted pairwise tests

  • Computational prediction:

    • Use AlphaFold-Multimer or similar tools to predict potential interaction partners

    • Molecular docking to assess binding energies

    • Network analysis to identify functional protein clusters

When analyzing results, researchers should implement controls to distinguish specific from non-specific interactions, including detergent-only controls and unrelated membrane protein controls.

How can researchers overcome solubility and stability issues with recombinant yjjB protein?

Membrane proteins like yjjB present significant challenges in expression and purification. Effective strategies to address these issues include:

  • Expression optimization:

    • Use specialized E. coli strains (C41/C43, Lemo21) designed for membrane protein expression

    • Lower induction temperature (16-20°C) to slow expression rate and improve folding

    • Reduce inducer concentration to prevent inclusion body formation

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ) to improve folding

  • Solubilization approaches:

    • Screen multiple detergents in parallel (DDM, LDAO, OG, CHAPS) at varying concentrations

    • Test detergent/lipid mixtures that better mimic native membrane environment

    • Consider amphipols or nanodiscs for downstream applications requiring detergent removal

  • Stability enhancement:

    • Add stabilizing agents to buffers (glycerol 10-20%, specific lipids, cholesteryl hemisuccinate)

    • Optimize buffer pH and ionic strength based on protein isoelectric point

    • Consider protein engineering approaches (thermostabilizing mutations, fusion partners)

  • Storage conditions:

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Store at -80°C for long-term stability

    • For working stocks, maintain at 4°C with protease inhibitors for up to one week

Systematic detergent screening using differential scanning fluorimetry can help identify optimal conditions for maintaining yjjB stability.

What strategies can address the challenges of antibody production against yjjB protein?

Generating high-quality antibodies against membrane proteins like yjjB presents unique challenges due to their hydrophobic nature and potential conformational epitopes. Researchers should consider:

  • Antigen preparation approaches:

    • Full-length protein in detergent micelles (preserves conformational epitopes)

    • Synthetic peptides from hydrophilic regions (typically N/C-termini and loops)

    • Fusion proteins with highly immunogenic partners (GST, MBP, KLH)

  • Immunization protocols:

    • Multiple host species to increase success probability (rabbit, mouse, chicken)

    • Extended immunization schedules with more frequent boosters

    • Varied adjuvant combinations (Freund's, alum, CpG oligonucleotides)

  • Antibody screening methods:

    • ELISA using multiple presentation formats of the antigen

    • Western blotting under both reducing and non-reducing conditions

    • Immunofluorescence on fixed and live cells expressing yjjB

    • Flow cytometry for cell-surface exposed epitopes

  • Validation approaches:

    • Reactivity with recombinant protein (both His-tagged and GST-tagged versions)

    • Specificity testing against related proteins (E. coli homologs)

    • Pre-absorption controls to confirm specificity

    • Testing on yjjB-knockout mutants as negative controls

Western blotting has confirmed the immunoreactivity of recombinant proteins rHis-SseB and rGST-SseB with antisera against Salmonella Enteritidis, suggesting similar approaches would be effective for yjjB protein detection .

What experimental approaches can determine the functional role of yjjB in Salmonella pathogenesis?

Despite being classified as a protein of unknown function (UPF), systematic approaches can elucidate yjjB's role in Salmonella pathogenesis:

  • Gene knockout studies:

    • Generate precise yjjB deletion mutants using CRISPR-Cas9 or lambda-Red recombination

    • Conduct phenotypic assays comparing wild-type and ΔyjjB strains:

      • Growth curves under various stress conditions

      • Invasion assays in epithelial cell lines

      • Survival in macrophage models

      • Virulence in animal infection models

  • Protein localization:

    • Create reporter fusions (GFP, mCherry) to determine subcellular localization

    • Conduct immunogold electron microscopy with anti-yjjB antibodies

    • Perform membrane fractionation studies to confirm membrane association

  • Interactome analysis:

    • Conduct pulldown assays followed by mass spectrometry

    • Bacterial two-hybrid screening to identify protein partners

    • Chemical crosslinking to capture transient interactions

  • Transcriptomic/proteomic comparisons:

    • RNA-Seq analysis of ΔyjjB vs. wild-type under infection-relevant conditions

    • Quantitative proteomics to identify differentially expressed proteins

    • Metabolomic profiling to detect altered metabolic pathways

  • Functional complementation:

    • Reintroduce wild-type and mutant versions of yjjB

    • Test specific domain mutations to identify critical functional regions

    • Assess cross-species complementation with E. coli homologs

These approaches can be integrated into a comprehensive experimental design that systematically evaluates potential roles of yjjB in membrane transport, stress response, or virulence regulation.

How can researchers effectively analyze cross-species conservation and evolutionary significance of yjjB protein?

Understanding the evolutionary context of yjjB provides insights into its functional importance and potential applications. Researchers should:

  • Comparative genomic analysis:

    • Conduct BLAST searches against diverse bacterial genomes

    • Create multiple sequence alignments of homologs

    • Generate phylogenetic trees to visualize evolutionary relationships

    • Identify conserved domains and motifs across species

  • Structural comparison:

    • Use AlphaFold or similar tools to predict structures across species

    • Compare structural conservation vs. sequence conservation

    • Identify structurally constrained regions as potentially functional domains

  • Selective pressure analysis:

    • Calculate dN/dS ratios to identify regions under purifying or positive selection

    • Map conservation scores onto structural models

    • Identify coevolving residues through statistical coupling analysis

  • Functional conservation assessment:

    • Test cross-species complementation with yjjB homologs

    • Compare phenotypes of knockout mutants across bacterial species

    • Analyze expression patterns under similar environmental conditions

The UPF0442 protein family shows significant conservation across Enterobacteriaceae, with homologs in E. coli, Salmonella, and Shigella species . Sequence analysis reveals >90% identity among Salmonella strains and approximately 80% identity with E. coli homologs, suggesting conserved functional importance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.