Recombinant Salmonella enteritidis PT4 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced in Escherichia coli via recombinant DNA technology . Key steps include:

  • Cloning: The yihY gene is codon-optimized, synthesized, and subcloned into expression vectors .

  • Expression: Induced using IPTG in E. coli BL21(DE3) or similar strains .

  • Purification: Affinity chromatography (Ni-NTA columns) followed by buffer exchange and lyophilization .

Comparative Expression Systems

VendorHost SystemPurityTag
Creative BioMart E. coli>90%His
MyBioSource E. coli/Yeast/Mammalian≥85%His or None
Gentaur Custom (E. coli, mammalian)>80%His, GST, etc.

Functional Role of Native YihY

YihY is a membrane-associated protein in Salmonella with potential roles in:

  • Virulence: Membrane proteins like YihY contribute to bacterial survival in hostile environments (e.g., egg albumen) .

  • Antimicrobial Resistance: Linked to genomic islands harboring resistance genes .

  • Membrane Biogenesis: Homology to ribonuclease BN suggests involvement in RNA processing .

Vaccine Development

  • Subunit vaccines: Recombinant YihY is tested as an antigen to elicit immune responses against Salmonella .

  • Example: Immunoreactivity confirmed via western blot using antisera from Salmonella-infected hosts .

Diagnostic Tools

  • Serves as a target for antibody production in ELISA and immunoblot assays .

Key Research Findings

  1. Immunogenicity: Recombinant YihY reacts with antisera from Salmonella-infected hosts, confirming its antigenic potential .

  2. Genomic Context: The yihY gene is adjacent to virulence factors in pathogenicity islands (SPI-1 to SPI-5) .

  3. Structural Homology: Shares functional motifs with E. coli YidC, a membrane protein insertase .

Limitations and Future Directions

  • Challenges: Low solubility in non-denaturing buffers .

  • Opportunities: Engineering tags (e.g., MBP, GST) to improve stability or testing in heterologous vaccine platforms .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol (final concentration) and aliquot to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag type, please inform us during your order; we will prioritize your request.
Synonyms
yihY; SEN3815; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
yihY
Target Protein Sequence
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
Uniprot No.

Target Background

Database Links

KEGG: set:SEN3815

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.