Recombinant Salmonella enteritidis PT4 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
zntB; SEN1375; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGSWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function

Mediates zinc ion efflux.

Database Links

KEGG: set:SEN1375

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ZntB in Salmonella enteritidis PT4?

ZntB functions as a zinc efflux transport system in Salmonella enterica, mediating the export of excess zinc (Zn²⁺) from the bacterial cell. This protein belongs to the CorA family of cation transporters, which are widely distributed among eubacteria. While the CorA family is traditionally associated with magnesium transport, ZntB specifically contributes to zinc homeostasis by facilitating zinc efflux . Biochemical analysis has confirmed that ZntB directly transports zinc out of bacterial cells, making it a critical component of Salmonella's metal detoxification machinery .

How does ZntB differ structurally and functionally from other zinc transporters in Salmonella?

ZntB is structurally homologous to the CorA family of Mg²⁺ transport proteins but has evolved specific functions for zinc transport. Unlike ZnuABC, which is a high-affinity zinc importer activated during zinc limitation, ZntB functions as an efflux pump to remove excess intracellular zinc . The protein contains transmembrane domains characteristic of metal transporters and operates alongside but distinctly from ZntA and ZitB, which are other zinc efflux systems in Salmonella . This functional specialization allows Salmonella to maintain precise zinc homeostasis under varying environmental conditions.

What genetic and regulatory mechanisms control zntB expression in Salmonella enteritidis?

The expression of zntB in Salmonella is regulated in response to intracellular zinc concentrations, though the specific regulatory mechanism differs from that of ZntA, which is controlled by the zinc-responsive regulator ZntR. While detailed studies on ZntB regulation are still emerging, evidence suggests that its expression increases under high zinc conditions, allowing the bacterium to effectively respond to zinc toxicity . The zntB locus is conserved across Salmonella serovars, indicating its evolutionary importance in bacterial metal homeostasis systems.

What are the recommended methods for expressing and purifying recombinant ZntB protein for structural studies?

For recombinant expression of Salmonella enteritidis PT4 ZntB, researchers should consider using E. coli expression systems with specialized vectors containing hexahistidine tags for efficient purification. The protein can be expressed in E. coli BL21(DE3) cells using IPTG induction, followed by metal affinity chromatography. For structural studies, size exclusion chromatography is essential to obtain monodisperse protein samples. Critical considerations include:

  • Maintaining reducing conditions with 1-5 mM DTT throughout purification to prevent cysteine-mediated aggregation

  • Including 0.1-0.5 mM zinc in buffers to stabilize the protein structure

  • Using detergents like DDM or LMNG for extraction if membrane-associated forms are being studied

  • Confirming protein integrity through circular dichroism and thermal stability assays before crystallization attempts

How can researchers effectively generate and validate zntB mutants in Salmonella enteritidis PT4?

To generate reliable zntB mutants in Salmonella enteritidis PT4, researchers should employ lambda Red recombinase-based approaches for precise gene deletion or mutation. The experimental workflow should include:

  • PCR amplification of antibiotic resistance cassettes flanked by 40-50bp homology regions matching the target zntB locus

  • Transformation of the PCR product into Salmonella expressing the lambda Red recombinase system

  • Selection on appropriate antibiotic media followed by PCR verification of the mutation

  • P22 phage transduction to move confirmed mutations into a clean genetic background

  • Validation through complementation studies using plasmid-expressed wild-type zntB

  • Phenotypic characterization including growth curve analysis in zinc-supplemented media (0.1-2.0 mM ZnSO₄) to confirm increased sensitivity to zinc in mutants

What analytical techniques are most effective for measuring ZntB-mediated zinc transport in vitro and in vivo?

For comprehensive analysis of ZntB-mediated zinc transport, researchers should employ multiple complementary techniques:

In vitro methods:

  • Reconstitution of purified ZntB into proteoliposomes loaded with zinc-sensitive fluorophores (FluoZin-3)

  • Measurement of zinc transport using radioisotope ⁶⁵Zn uptake/efflux assays with membrane vesicles

  • Isothermal titration calorimetry to determine zinc binding affinities and stoichiometry

In vivo methods:

  • Intracellular zinc quantification using genetically encoded zinc sensors (e.g., FRET-based)

  • Growth phenotype analysis in zinc-supplemented media comparing wild-type and ΔzntB strains

  • Real-time PCR monitoring of zinc-responsive genes to assess intracellular zinc status

  • Inductively coupled plasma mass spectrometry (ICP-MS) measurement of total cellular zinc content under varying environmental conditions

How does ZntB contribute to Salmonella virulence during infection of different host types?

ZntB plays a significant role in Salmonella virulence by contributing to zinc homeostasis during infection. While ZntB-specific studies are still emerging, research on zinc efflux systems in Salmonella has demonstrated that these transporters are crucial for pathogenesis through several mechanisms:

  • Protection against zinc toxicity during host-induced metal poisoning (nutritional immunity)

  • Contribution to bacterial survival within macrophages, where zinc levels can fluctuate dramatically

  • Enhancement of resistance against nitrosative stress, as nitric oxide disrupts zinc metalloproteins and mobilizes free zinc within bacterial cells

  • Support of bacterial colonization in zinc-rich microenvironments within the host

In mouse models of infection, zinc efflux systems including ZntB facilitate Salmonella survival in NO·-producing environments and are required for full virulence . Additionally, these systems support the bacteria's ability to colonize plant tissues, suggesting a role in environmental persistence and transmission .

What is the relationship between ZntB function and nitric oxide (NO·) resistance in Salmonella during host immune responses?

The relationship between ZntB function and nitric oxide resistance represents a critical aspect of Salmonella pathogenesis. Research indicates that:

  • Nitric oxide (NO·) produced by activated macrophages disrupts zinc metalloproteins in Salmonella, including essential proteins involved in DNA replication (DnaG, PriA) and metabolism

  • This disruption mobilizes free zinc within bacterial cells, potentially reaching toxic concentrations

  • Zinc efflux systems, including ZntB alongside ZntA and ZitB, mitigate this NO·-dependent zinc toxicity

  • These transporters are required for Salmonella resistance to both zinc overload and nitrosative stress

Studies have demonstrated that zinc efflux ameliorates NO·-dependent zinc mobilization following internalization by activated macrophages and is required for virulence in NO·-producing mice. This indicates that host-derived NO· causes zinc stress in intracellular bacteria, which must be countered by zinc efflux systems for successful infection .

How does ZntB function compare between acute and chronic Salmonella infection models?

The function of zinc transport systems, including ZntB, differs significantly between acute and chronic Salmonella infection models, reflecting the changing demands of different infection stages:

Acute infection phase:

  • Zinc efflux systems protect against immediate host-induced zinc toxicity

  • ZntB works alongside other efflux systems to counter the rapid zinc fluctuations during initial host response

  • Expression may be upregulated in response to inflammatory conditions

Chronic infection phase:

  • More subtle regulation of zinc homeostasis becomes important for long-term persistence

  • ZntB likely contributes to establishing a balanced intracellular zinc level that supports bacterial survival without triggering excessive host immune responses

  • The system may interact with host Nramp1 (natural resistance-associated macrophage protein 1), a key determinant of host resistance to chronic Salmonella infection

Research with Nramp1-positive mouse models has revealed that chronic Salmonella infections are characterized by a balance between pathogen persistence and host clearance mechanisms, with metal homeostasis playing a critical role in this equilibrium . The different Nramp1 status of mouse strains affects infection outcomes as shown in the table below:

Mouse strainNramp1 statusSusceptibility to chronic infection
C57BL/6Nramp1 mt/mtHigh susceptibility
BALB/cNramp1 mt/mtHigh susceptibility
DBANramp1 wt/wtResistant
C3H/HeJNramp1 wt/wtResistant
CBANramp1 wt/wtResistant
129 SvJNramp1 wt/wtResistant

(mt, mutated allele; wt, wild-type allele)

How do the structure and function of ZntB compare across different Salmonella serovars and related enteric bacteria?

ZntB shows significant conservation across Salmonella serovars and related enteric bacteria, reflecting its fundamental importance in bacterial zinc homeostasis. Comparative analysis reveals:

  • The ZntB protein sequence exhibits high homology (>90%) among Salmonella enterica serovars, including Typhimurium, Enteritidis, and Typhi

  • The protein belongs to the CorA family of transporters but has evolved specialized functions for zinc transport rather than magnesium transport

  • ZntB homologs are widely distributed among enteric bacteria, with functional conservation across genera including Escherichia, Shigella, and Klebsiella

  • Despite sequence conservation, minor structural variations may contribute to differences in transport efficiency or regulatory control across bacterial species

Phylogenetic analysis suggests that ZntB evolved from ancestral CorA transporters through functional diversification, representing an example of how metal transport systems can adapt to serve different physiological roles while maintaining structural similarity .

What functional overlap exists between ZntB and other zinc efflux systems (ZntA, ZitB) in Salmonella enteritidis?

The zinc efflux systems in Salmonella demonstrate both functional overlap and specialization:

  • ZntA, ZitB, and ZntB all contribute to zinc efflux, but with differing affinities, capacities, and regulation

  • ZntA, a P₁B-type ATPase, is the primary high-affinity zinc exporter activated under severe zinc stress and is regulated by ZntR

  • ZitB, a cation diffusion facilitator family member, provides constitutive low-level zinc efflux under normal conditions

  • ZntB offers complementary efflux capacity, with its unique evolutionary relationship to magnesium transporters potentially providing distinctive transport kinetics

Research demonstrates that these systems work cooperatively, with considerable functional redundancy. Mutations in multiple efflux systems produce more severe zinc sensitivity than single mutations. For example, studies have shown that ZntA and ZitB together significantly ameliorate the cytotoxic effects of free zinc during infection and are required for resistance to nitrosative stress .

What evolutionary advantages does the acquisition of ZntB provide to Salmonella compared to other enteric pathogens?

The evolutionary acquisition and retention of ZntB provides Salmonella with several adaptive advantages:

  • Enhanced environmental versatility, allowing Salmonella to colonize diverse niches with varying zinc concentrations

  • Improved resistance to host immune defenses, particularly against macrophage-generated nitric oxide that mobilizes toxic zinc levels

  • Greater resilience during transitions between host environments and external settings

  • Potential advantages during competition with other microorganisms in the inflamed gut

These advantages are particularly relevant to Salmonella's lifecycle, which involves transitions between host intestinal environments, systemic spread, and environmental persistence. The ability to precisely regulate zinc levels through multiple complementary systems like ZntB contributes to Salmonella's success as both an intestinal and systemic pathogen capable of establishing persistent infections .

What recent technological advances have improved our understanding of ZntB structure-function relationships?

Recent technological advances have significantly enhanced our understanding of zinc transport proteins like ZntB:

  • Cryo-electron microscopy (Cryo-EM) now enables visualization of membrane transporters in different conformational states, revealing the structural basis of zinc transport without the constraints of crystallization

  • Advanced membrane protein expression systems, including synthetic lipid nanodiscs, allow for functional studies in near-native environments

  • Molecular dynamics simulations can predict ion permeation pathways and conformational changes during transport cycles

  • High-throughput mutagenesis coupled with growth phenotype screening has identified critical residues for ZntB function

  • Advanced metal-sensing fluorescent probes enable real-time tracking of zinc movement in living bacterial cells

These technologies have begun to reveal how ZntB's structure relates to its selective transport of zinc over other divalent cations like magnesium, despite its evolutionary relationship to magnesium transporters .

How might targeting ZntB function provide novel approaches for antimicrobial development against Salmonella?

Targeting ZntB and related zinc homeostasis systems represents a promising strategy for novel antimicrobial development against Salmonella:

  • Inhibitors of zinc efflux could increase intracellular zinc to toxic levels, particularly in combination with host-derived nitric oxide that mobilizes intracellular zinc

  • Small molecules that lock ZntB in specific conformational states could prevent efficient zinc efflux

  • Peptides designed to interfere with oligomerization of ZntB subunits could disrupt transport function

  • Compounds that enhance zinc toxicity could synergize with traditional antibiotics, potentially overcoming resistance mechanisms

  • Vaccine strategies targeting surface-exposed regions of membrane-embedded ZntB could stimulate protective immunity

The fact that zinc efflux systems are required for full virulence in animal models suggests that such approaches might selectively target pathogenic bacteria during infection while having minimal effects on commensal microbiota or host cells .

What methodological challenges remain in studying ZntB and other zinc transporters in the context of host-pathogen interactions?

Despite significant advances, several methodological challenges persist in studying zinc transporters like ZntB during host-pathogen interactions:

  • Difficulty in precisely measuring zinc concentrations within specific subcellular compartments during infection

  • Limitations in simultaneously tracking bacterial and host zinc pools during infection processes

  • Challenges in distinguishing the specific contributions of individual zinc transporters due to functional redundancy

  • Limited availability of relevant animal models that accurately reflect human zinc homeostasis during infection

  • Technical hurdles in developing high-throughput screening assays for zinc transporter inhibitors

  • Complexity in translating in vitro transport observations to in vivo infection contexts

Future research will require interdisciplinary approaches combining bacterial genetics, advanced imaging, host-pathogen modeling, and computational biology to overcome these challenges. Development of Nramp1-positive mouse models that better mimic human Salmonella infections while enabling genetic manipulation will be particularly valuable for studying zinc transport in chronic infection contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.