Recombinant Salmonella gallinarum 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

UbiA catalyzes the transfer of an octaprenyl group from farnesyl diphosphate to PHB, forming 3-octaprenyl-4-hydroxybenzoate—a key step in ubiquinone biosynthesis . The reaction involves:

  1. Substrate Binding: PHB and octaprenyl diphosphate bind to hydrophobic pockets in the enzyme’s transmembrane domain .

  2. Catalytic Activity: Cleavage of diphosphate generates a carbocation intermediate, which reacts with PHB’s meta-position to form a C–C bond .

  3. Cofactor Requirement: Mg²⁺ is essential for optimal activity .

The enzyme is membrane-bound, reflecting its role in lipid-soluble quinone production .

3.1. Ubiquinone Biosynthesis Studies

  • UbiA-deficient mutants in E. coli fail to synthesize ubiquinones, confirming its indispensability in respiratory chain function .

  • Structural studies of UbiA homologs (e.g., COQ2 in humans) provide insights into substrate specificity and inhibition strategies for metabolic disorders .

3.2. Vaccine Development

While not directly used in vaccines, recombinant S. gallinarum strains lacking virulence genes (e.g., SpvB or SPI-14) are engineered for poultry vaccines . UbiA’s role in bacterial metabolism makes it a potential target for attenuating pathogenic strains.

Comparative Data on Recombinant UbiA Variants

ParameterCreative Biomart Cusabio
Expression HostE. coliYeast
TagHis tagUndetermined (varies by manufacturing)
Purity>90%>85%
ReconstitutionTris/PBS buffer + 6% trehaloseDeionized water + glycerol (5–50%)

Stability and Handling

  • Storage: Long-term storage at -80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Centrifuge lyophilized powder before adding sterile water or glycerol-containing buffers .

Future Directions

  • Structural Resolution: Crystallography of S. gallinarum UbiA could elucidate mechanisms of substrate selectivity within the UbiA superfamily .

  • Metabolic Engineering: Modifying UbiA activity might enhance ubiquinone production in industrial microbial strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; SG4077; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It plays a crucial role in the second step of the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. Specifically, it mediates the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: seg:SG4077

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its function in Salmonella gallinarum?

4-hydroxybenzoate octaprenyltransferase (ubiA) is a membrane-bound enzyme that catalyzes a critical step in ubiquinone biosynthesis, specifically the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate . In Salmonella gallinarum, as in other bacteria, this enzyme plays an essential role in the electron transport chain by facilitating ubiquinone production . The enzyme requires Mg²⁺ for optimal activity and is encoded by the ubiA gene, which has been mapped to specific chromosomal locations in related bacteria such as E. coli (minute 79 on the chromosome map) . Functionally, the ubiA gene is considered a structural gene coding for this enzyme, as demonstrated by studies showing that ubiA⁻ mutants lack 4-hydroxybenzoate octaprenyltransferase activity .

How is the ubiA gene structurally characterized in Salmonella gallinarum?

The ubiA gene in Salmonella gallinarum encodes a protein of 290 amino acids that functions as 4-hydroxybenzoate octaprenyltransferase . The protein sequence contains multiple transmembrane domains consistent with its membrane-bound nature . The complete amino acid sequence includes characteristic hydrophobic regions that anchor the protein in the cell membrane, which is essential for its enzymatic function . Structurally, the protein contains several conserved domains typical of prenyltransferases, including binding sites for both the aromatic substrate (4-hydroxybenzoate) and the prenyl donor (octaprenyl pyrophosphate) . The gene is typically expressed in conjunction with other genes involved in the ubiquinone biosynthesis pathway, suggesting coordinated regulation of these biosynthetic enzymes .

What expression systems are currently used for producing recombinant Salmonella gallinarum ubiA protein?

Recombinant Salmonella gallinarum ubiA protein can be produced using several expression systems, with selection depending on research requirements. Common expression platforms include E. coli, yeast, baculovirus, and mammalian cell systems . For research purposes, E. coli is frequently used due to its high yield, rapid growth, and established protocols for membrane protein expression . When preparing functional ubiA protein, consideration must be given to its membrane-bound nature, which may require specific solubilization techniques or the use of detergents during purification . Expression vectors typically incorporate affinity tags to facilitate purification, though these may be determined during the production process to optimize protein functionality . For structural studies or when post-translational modifications are important, eukaryotic expression systems like yeast or mammalian cells might be preferred despite their typically lower yields .

How can researchers verify the expression and activity of recombinant ubiA protein?

Verification of recombinant ubiA protein expression and activity involves multiple complementary techniques. Initially, protein expression can be confirmed via Western blotting using specific antibodies against either the ubiA protein or any incorporated affinity tags . Enzymatic activity can be assessed through an in vitro assay measuring the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate in the presence of the prenyl donor (octaprenyl pyrophosphate) and Mg²⁺ . This conversion can be monitored using chromatographic techniques such as HPLC or LC-MS to detect the prenylated product . Additionally, functional complementation studies can be performed by introducing the recombinant ubiA gene into ubiA-deficient bacterial strains and assessing restoration of ubiquinone biosynthesis and related phenotypes . For membrane proteins like ubiA, researchers should also verify proper membrane localization using cellular fractionation followed by immunodetection in membrane fractions .

What methodologies can be used to study the role of ubiA in Salmonella gallinarum virulence?

To investigate the role of ubiA in Salmonella gallinarum virulence, researchers can employ multiple complementary approaches. First, targeted gene deletion or disruption techniques should be used to create ubiA-deficient mutants through homologous recombination or CRISPR-Cas9 systems, followed by comprehensive phenotypic characterization . In vitro assessments should include growth kinetics in standard and stress conditions (oxidative stress, pH variation, nutrient limitation), membrane integrity assays, and antibiotic susceptibility testing . Cell culture models can evaluate bacterial adhesion, invasion, and intracellular survival within avian macrophages or epithelial cells .

For in vivo virulence assessment, chicken infection models are essential, with both oral and intravenous challenge routes to distinguish between colonization and systemic infection capabilities . Bacterial burden should be quantified in key organs (liver, spleen, cecum) at multiple time points post-infection (5, 15, 25, 35, and 45 days) to assess persistence and dissemination . Immune response evaluation should include measurement of both humoral (serum IgG, mucosal sIgA) and cell-mediated responses (cytokine profiling, T-cell activation) . Complementation studies reintroducing functional ubiA are crucial to confirm phenotype specificity, and comparative transcriptomics or proteomics between wild-type and ubiA mutants can reveal affected pathways .

How can recombinant Salmonella gallinarum strains expressing modified ubiA be designed for vaccine development?

Designing recombinant Salmonella gallinarum strains with modified ubiA for vaccine development requires a methodical approach integrating molecular biology and immunology principles. Initially, researchers should create an attenuated S. gallinarum base strain through targeted mutations in virulence genes (such as wecB) that reduce pathogenicity while maintaining immunogenicity . The ubiA gene can then be modified to optimize expression levels or alter enzymatic activity, potentially creating a metabolic bottleneck that further attenuates virulence .

For enhanced vaccine efficacy, the ubiA gene can be engineered as a fusion protein with immunogenic antigens from target pathogens, such as the APEC type I fimbriae (fim) gene cluster . Expression systems using chromosome-plasmid-balanced lethal mechanisms ensure stable antigen expression without antibiotic selection pressure . Candidate vaccine strains must undergo rigorous safety testing including genetic stability assessment across multiple passages and reversion frequency measurement .

Immunogenicity evaluation should follow a systematic protocol: initial dose-response studies to determine optimal immunization dose (typically 5 × 10⁹ CFU for oral administration), assessment of multiple immunization routes (oral, intraperitoneal, subcutaneous), and measurement of both antigen-specific humoral (IgG, IgA) and cell-mediated immune responses . Protective efficacy must be validated through challenge studies with virulent strains, measuring survival rates, bacterial clearance, and organ pathology . The table below summarizes a typical immunization and challenge assessment protocol:

ParameterPrimary ImmunizationBoosterChallengeAssessment Points
Dose5 × 10⁹ CFU5 × 10⁹ CFU50 LD₅₀ of virulent strainDays 0, 14, 28
RouteOralOralIntravenous/Intraperitoneal-
Immune Response MeasurementIgG, sIgA levelsEnhanced responseSurvival rate, bacterial clearance14 days post-immunization
Expected Protection--60-65% survival45 days post-challenge

What techniques are available for structural characterization of the ubiA protein and how can this information advance drug discovery?

Structural characterization of the ubiA protein involves multiple complementary techniques. X-ray crystallography remains the gold standard for membrane proteins like ubiA, though it requires optimization of detergent conditions and crystallization parameters . Cryo-electron microscopy (cryo-EM) offers advantages for membrane proteins that resist crystallization, potentially revealing dynamic conformational states . NMR spectroscopy can provide information on protein dynamics and ligand interactions, particularly useful for identifying binding sites . Computational approaches including homology modeling based on related prenyltransferases complement experimental methods, especially when crystal structures are unavailable .

For drug discovery applications, structure-based virtual screening can identify potential inhibitors by docking compound libraries against the active site of ubiA . Molecular dynamics simulations can reveal binding mechanisms and conformational changes upon inhibitor binding . Site-directed mutagenesis guided by structural data can validate binding sites and mechanism predictions . Fragment-based drug discovery approaches are particularly suitable for ubiA due to the well-defined binding pockets for both substrate and prenyl donor .

A systematic drug discovery workflow might include:

  • Initial screening of compound libraries against recombinant ubiA using enzymatic assays

  • Secondary screening with bacterial growth inhibition assays

  • Lead optimization guided by structure-activity relationships

  • Pharmacokinetic/pharmacodynamic assessment in animal models

  • Resistance development studies to assess evolutionary barriers

Targeting ubiA offers a distinctive advantage for antimicrobial development due to its essential role in bacterial respiration and limited homology with eukaryotic counterparts .

How does the function of ubiA in Salmonella gallinarum compare with homologous proteins in other pathogenic bacteria?

The function of ubiA in Salmonella gallinarum shows both conservation and divergence when compared with homologous proteins in other pathogenic bacteria. At the sequence level, ubiA proteins demonstrate high conservation across Enterobacteriaceae, with approximately 85-95% amino acid identity between S. gallinarum, E. coli, and S. paratyphi A . This conservation extends to critical functional domains including substrate binding sites and membrane-spanning regions . All bacterial ubiA homologs catalyze the same fundamental reaction—the prenylation of 4-hydroxybenzoate—though the length of the prenyl chain may vary between species (octaprenyl in Enterobacteriaceae, menaquinone in some Gram-positive bacteria) .

Despite functional similarities, significant differences exist in the regulation of ubiA expression and its role in pathogenesis across bacterial species. In S. gallinarum, which causes fowl typhoid, ubiA appears to contribute to systemic infection capabilities . This contrasts with E. coli, where ubiA mutations primarily affect growth under aerobic conditions but have less impact on pathogenicity . S. paratyphi A, a human pathogen, shows yet another pattern where ubiA function may affect host-specific adaptation .

What is the interplay between ubiA function and other virulence factors in Salmonella gallinarum pathogenesis?

The interplay between ubiA function and other virulence factors in Salmonella gallinarum creates a complex network affecting pathogenicity. As a component of the ubiquinone biosynthesis pathway, ubiA influences energy metabolism, which indirectly impacts numerous virulence mechanisms . Evidence suggests that compromised ubiquinone production affects membrane potential and proton motive force, potentially altering the function of type III secretion systems essential for host cell invasion and intracellular survival .

A particularly significant interaction exists between ubiA and the enterobacterial common antigen (ECA) biosynthesis pathway, as demonstrated by studies on the wecB gene . Mutations in wecB, which encodes UDP-N-acetylglucosamine 2-epimerase, result in ECA-negative phenotypes with increased sensitivity to bile salts and significantly attenuated virulence in chickens . This suggests that proper membrane composition and integrity, influenced by both ubiA and wec genes, are critical for S. gallinarum survival in host environments .

The bacterial stress response system also intersects with ubiA function. Under oxidative stress conditions commonly encountered during host infection, ubiquinone production becomes particularly important for maintaining redox balance . This may explain why ubiA-deficient strains show reduced persistence in host tissues despite initially successful invasion . Furthermore, temporal expression analysis indicates that ubiA regulation is coordinated with other virulence genes during different infection phases, suggesting integration into global virulence regulatory networks .

From an experimental perspective, the development of recombinant S. gallinarum vaccine strains demonstrates how this interplay can be exploited for immunological purposes. For example, the SG102 strain, which expresses APEC type I fimbriae on S. gallinarum, shows enhanced immunogenicity compared to control strains, suggesting that modifying surface structures in conjunction with maintaining appropriate metabolic function (via intact ubiA) produces optimal vaccine candidates .

What are the optimal conditions for expressing and purifying recombinant Salmonella gallinarum ubiA?

Optimal expression and purification of recombinant Salmonella gallinarum ubiA requires careful consideration of its membrane-bound nature. For expression, E. coli BL21(DE3) or C41(DE3) strains specifically designed for membrane protein expression are recommended . Expression vectors should include inducible promoters (T7 or arabinose-inducible) with moderate strength to prevent toxicity from protein overexpression . Fusion tags such as His₆ or Strep-tag II facilitate purification while malE (MBP) or GST fusions may improve solubility .

Optimal growth conditions include cultivation at reduced temperatures (16-20°C) after induction to slow expression and improve folding . Supplementation with Mg²⁺ (5-10 mM) is essential as this is a cofactor for ubiA activity . Membrane extraction requires careful solubilization with mild detergents, with n-dodecyl-β-D-maltoside (DDM) at 1-2% or digitonin at 1% being preferred choices that maintain protein structure and function .

For purification, immobilized metal affinity chromatography (IMAC) with Ni²⁺ or Co²⁺ resins is effective for His-tagged constructs, followed by size exclusion chromatography to remove aggregates . Throughout purification, maintaining a detergent concentration above the critical micelle concentration is crucial . Activity can be preserved by including glycerol (20-50%) and reducing agents in storage buffers . Final preparations should be validated by both SDS-PAGE and functional assays measuring 4-hydroxybenzoate prenylation activity .

How can researchers design effective mutagenesis studies to investigate ubiA function in Salmonella gallinarum?

Designing effective mutagenesis studies for ubiA requires a systematic approach targeting key functional domains. Site-directed mutagenesis should focus on conserved residues identified through sequence alignment with homologous proteins in E. coli and other bacteria . Priority targets include the substrate binding site, prenyl pyrophosphate binding residues, and catalytic amino acids . Alanine-scanning mutagenesis of transmembrane regions can identify critical membrane-integration determinants .

For creating knockout mutants, allelic exchange methods using suicide vectors (pKO3, pRE112) with counterselectable markers (sacB) are effective in Salmonella . CRISPR-Cas9 systems adapted for Salmonella provide efficient targeted mutagenesis with reduced off-target effects . When designing knockout constructs, researchers must consider polar effects on downstream genes in the same operon, potentially requiring in-frame deletion strategies .

Phenotypic characterization should include growth assessment under different oxygen tensions (aerobic, microaerobic, anaerobic), as ubiquinone requirements vary with respiratory conditions . Complementation studies are essential to confirm phenotype specificity, ideally using inducible promoters to titrate expression levels . For studying essential genes like ubiA, conditional mutagenesis using tetracycline-responsive promoters allows controlled depletion .

The table below outlines key residues for site-directed mutagenesis based on conserved domains in prenyltransferases:

DomainTarget ResiduesExpected EffectValidation Method
Substrate BindingD72, H43, R137Decreased substrate affinityEnzyme kinetics (Km)
Prenyl BindingR195, N211, R265Altered chain-length specificityProduct analysis by LC-MS
CatalyticD191, K146Complete loss of activityComplementation assay
Membrane AssociationW22, F28, L35 (TM regions)MislocalizationMembrane fractionation

What are the challenges in developing high-throughput screening assays for ubiA inhibitors?

Developing high-throughput screening (HTS) assays for ubiA inhibitors presents several technical challenges. First, the membrane-bound nature of ubiA requires careful consideration of detergent conditions that maintain enzymatic activity while allowing consistent assay performance across large compound libraries . Standard detergents like DDM may interfere with some detection methods or compound binding .

The enzymatic reaction itself poses challenges for detection, as neither substrate (4-hydroxybenzoate) nor product (3-octaprenyl-4-hydroxybenzoate) has strong intrinsic fluorescence or absorbance properties that allow direct monitoring . Developing coupled enzyme assays that link the reaction to measurable signals (fluorescence, luminescence) requires careful optimization to ensure that ubiA activity remains rate-limiting .

Substrate availability presents another hurdle, as the prenyl donor (octaprenyl pyrophosphate) is not commercially available and must be enzymatically synthesized or isolated from bacterial sources . This limited availability impacts assay scalability and reproducibility in HTS campaigns .

False positives often arise from compounds that aggregate or denature membrane proteins non-specifically, necessitating robust counter-screening cascades . To address these challenges, researchers have developed several innovative approaches:

  • Fluorescence-based assays using synthetic prenyl donors with attached fluorophores

  • Radiolabeled substrate approaches for higher sensitivity, though with throughput limitations

  • Whole-cell phenotypic screens using ubiA-dependent reporter strains

  • Fragment-based approaches using thermal shift assays to identify binding events

Successful implementation requires rigorous validation with known prenyltransferase inhibitors and careful selection of positive and negative controls to normalize plate-to-plate variation .

What are promising applications of recombinant Salmonella gallinarum ubiA in vaccine development?

Recombinant Salmonella gallinarum ubiA offers several promising applications in vaccine development. The enzyme could be exploited in attenuated live vaccine design by creating conditional or reduced-function ubiA variants that maintain immunogenicity while reducing virulence . Such strains would exhibit compromised growth in host tissues while still stimulating robust immune responses . The persistence of attenuated strains (up to 25 days post-infection at low levels) makes them particularly suitable for inducing long-lasting immunity .

An innovative approach involves using ubiA-attenuated S. gallinarum as a vector for heterologous antigen delivery . By genetically fusing immunogenic epitopes from various poultry pathogens to ubiA or co-expressing them from stable plasmids, multivalent vaccines could be developed . The SG102 strain demonstrates this principle by expressing APEC type I fimbriae on S. gallinarum, inducing protection against both fowl typhoid and APEC infection with survival rates of 60-65% after challenge with virulent strains .

The chromosome-plasmid-balanced lethal system used in these constructs ensures stable antigen expression without antibiotic selection pressure, addressing regulatory concerns for live vaccines . Furthermore, oral administration routes compatible with mass vaccination in poultry production make these vaccines practically deployable . Protective immunity correlates with both humoral (IgG concentrations of ~221.50 μg/mL) and mucosal responses (sIgA levels of ~1.68 μg/mL), suggesting robust protection mechanisms .

How might comparative genomics of ubiA across Salmonella serovars inform host-adaptation mechanisms?

Comparative genomics of ubiA across Salmonella serovars could provide significant insights into host-adaptation mechanisms. Sequence analysis reveals subtle but potentially important variations in the ubiA gene and its regulatory elements across host-restricted serovars (like S. gallinarum in poultry), host-adapted serovars (like S. Dublin in cattle), and broad-host-range serovars (like S. Typhimurium) .

These genetic differences may translate to functional variations in ubiquinone synthesis efficiency under different host environmental conditions . For instance, S. gallinarum, which causes systemic infection in chickens, might have evolved ubiA variants optimized for function at avian body temperature (42°C) and within the unique redox environment of avian macrophages . Comparative analysis of ubiA promoter regions could reveal serovar-specific transcriptional regulation that aligns with host adaptation strategies .

Researchers should employ techniques including whole-genome sequencing across diverse isolates, analysis of selection pressure on ubiA codons, and experimental validation through heterologous expression of ubiA variants in standardized genetic backgrounds . Functional characterization should include enzyme kinetics across varying temperatures, pH values, and ion concentrations relevant to different host environments . Integration of these data with information about other metabolic pathways affected by ubiquinone production could reveal how energy metabolism adaptation contributes to host specificity .

Additionally, examination of horizontal gene transfer patterns affecting ubiA and neighboring genes might identify evolutionary events that contributed to host-jumping or restriction, providing valuable insights for predicting emerging pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.