Recombinant Salmonella gallinarum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
atpF; SG3564; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEVQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links

KEGG: seg:SG3564

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structure and function of Salmonella gallinarum ATP synthase subunit b (atpF)?

ATP synthase subunit b (atpF) is a critical component of the F1Fo ATP synthase complex in Salmonella gallinarum. This protein functions as part of the Fo sector that forms the proton channel across the bacterial membrane. Structurally, it consists of 156 amino acids with the sequence: MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEVQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL .

The Fo sector, which includes the a and b subunits, is responsible for coupling proton translocation to ATP synthesis/hydrolysis. The b subunit specifically acts as a peripheral stalk that connects the membrane-embedded Fo sector to the catalytic F1 sector, maintaining structural stability during the rotational catalysis mechanism of the ATP synthase complex .

How does the Salmonella ATP synthase complex contribute to bacterial virulence?

The ATP synthase complex plays a dual role in Salmonella virulence. First, it provides the necessary energy for bacterial survival within host cells. Second, it serves as a target for virulence proteins that modulate bacterial metabolism during infection.

Research has demonstrated that virulence proteins, particularly MgtC, interact directly with the F1Fo ATP synthase complex to regulate ATP levels and intracellular pH during infection. MgtC specifically binds to the a subunit of the F1Fo ATP synthase, hindering ATP-driven proton translocation and NADH-driven ATP synthesis in inverted vesicles . This interaction is critical for Salmonella survival within macrophages, as it helps maintain physiological ATP levels and cytoplasmic pH in the acidic phagosomal environment .

This regulation mechanism represents a unique virulence strategy where, unlike conventional virulence factors that target host proteins, MgtC targets Salmonella's own ATP synthase to enhance pathogen survival within the host cell environment .

What methods are commonly used to express and purify recombinant Salmonella gallinarum atpF protein?

Recombinant expression of Salmonella gallinarum atpF typically employs Escherichia coli expression systems due to their high efficiency and well-established protocols. The methodological approach includes:

  • Vector selection: The pET expression system is frequently used due to its high-level protein expression capability, where the target protein can represent up to 50% of the total cell protein . This system utilizes the T7 promoter with the gene of interest cloned behind a promoter recognized by the phage T7 RNA polymerase.

  • Expression conditions optimization:

    • Temperature: Usually lowered to 16-30°C to reduce inclusion body formation

    • Induction timing: Mid-log phase (OD600 ~0.6-0.8)

    • Inducer concentration: Typically 0.1-1.0 mM IPTG for T7-based systems

  • Purification strategy: Given that atpF is a membrane-associated protein, purification typically involves:

    • Cell lysis under native conditions

    • Membrane fraction isolation through differential centrifugation

    • Detergent solubilization (commonly using non-ionic detergents)

    • Affinity chromatography using tags such as His6-tag

    • Size exclusion chromatography for final polishing

  • Storage considerations: The purified protein is typically stored in Tris-based buffer with 50% glycerol optimized for stability, and maintained at -20°C for short-term or -80°C for extended storage to prevent repeated freeze-thaw cycles .

How can recombinant atpF be utilized in the development of attenuated Salmonella gallinarum vaccines?

Recombinant atpF can be strategically employed in attenuated Salmonella gallinarum vaccine development through several sophisticated approaches:

Regulated expression systems: By placing atpF under the control of regulated promoters such as the arabinose-inducible PBAD promoter, researchers can create strains with regulated delayed attenuation. This approach allows the bacteria to maintain sufficient ATP synthase functionality during initial colonization while attenuating virulence in later stages of infection .

Mutation design strategies: Rather than complete deletion, targeted amino acid substitutions in atpF can be introduced to alter ATP synthase efficiency without completely eliminating function. This creates a balanced attenuation that maintains immunogenicity while reducing pathogenicity .

Multi-antigen presentation platforms: Recombinant S. gallinarum expressing modified atpF can be engineered to simultaneously express heterologous antigens from other avian pathogens. For example, a recombinant S. gallinarum strain (SG102) was developed to express APEC type I fimbriae on its surface, creating a bivalent vaccine candidate against both fowl typhoid and avian pathogenic E. coli infections .

Immunomodulatory adjuvant incorporation: The immunogenicity of recombinant S. gallinarum vaccines can be enhanced by co-expressing immunomodulatory molecules. For instance, the E. coli heat-labile enterotoxin B subunit (LTB) has been used as an adjuvant in S. gallinarum vaccines, significantly increasing intestinal secretory IgA (sIgA) responses compared to commercial SG 9R vaccines .

Research data demonstrates that properly attenuated S. gallinarum vaccines provide robust protection: chickens immunized with a lon/cpxR/asd deletion mutant expressing LTB exhibited only 4% mortality compared to 46% in unvaccinated controls when challenged with wild-type S. gallinarum .

What are the experimental challenges in studying atpF interactions with virulence proteins like MgtC?

Investigating interactions between atpF and virulence proteins presents several methodological challenges that require sophisticated experimental approaches:

Membrane protein complex isolation: The F1Fo ATP synthase complex, including atpF, is membrane-embedded, making it difficult to study in its native state. Researchers must carefully optimize detergent solubilization conditions to maintain protein-protein interactions while extracting the complex from membranes.

Interaction specificity validation: Studies have shown that MgtC specifically interacts with the a subunit of F1Fo ATP synthase , but determining whether there are secondary interactions with atpF requires multiple complementary methods:

  • Co-immunoprecipitation with antibodies specific to atpF

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Cross-linking followed by mass spectrometry

Functional impact assessment: Distinguishing between direct physical interactions and indirect functional effects requires inverted membrane vesicle experiments. For example, researchers have demonstrated that vesicles prepared from wild-type Salmonella released less phosphate than those from isogenic mgtC mutants (indicating ATP hydrolysis inhibition), and NADH-driven ATP synthesis was monitored using luciferase reactions to measure ATP levels .

Single mutation effects analysis: Single amino acid substitutions in MgtC that attenuate Salmonella pathogenicity can prevent interaction with the ATP synthase complex . Mapping these critical residues requires systematic mutagenesis and subsequent functional assays.

Control experiments: Critical controls must include demonstration that observed effects are dependent on specific components. For instance, research showed that the MgtC effect is dependent on the Fo a subunit because there was no difference in phosphate release between vesicles prepared from an atpB single mutant and an atpB mgtC double mutant .

How does atpF contribute to Salmonella gallinarum adaptation to different environmental conditions during infection?

The atpF subunit plays a key role in S. gallinarum adaptation to challenging host environments through dynamic regulation of ATP synthesis and energy metabolism:

Phagosomal adaptation mechanisms: Within the acidic phagosome, S. gallinarum must maintain physiological cytoplasmic pH. Research indicates that ATP synthase function, which involves atpF, is critical for this adaptation. Studies demonstrate that MgtC protein interaction with the ATP synthase complex helps maintain approximately 2.2-fold lower ATP levels in wild-type Salmonella compared to mgtC mutants, which correlates with more stable cytoplasmic pH regulation .

Low magnesium adaptation: Under magnesium-limited conditions, which occur within host cells, bacteria need to reduce their ATP levels as ATP exists as a Mg2+ salt in living cells. The ATP synthase complex participation in this adaptation is evidenced by experiments showing that expressing the α, β, and γ components of the F1 subunit (which increases ATPase activity) restored growth of mgtC mutants to wild-type levels during magnesium limitation .

Energy balance during cellulose production: Research has revealed an interesting correlation between ATP levels, cyclic diguanylate (c-di-GMP) signaling, and cellulose production in Salmonella. Heightened ATP levels promote cellulose biosynthesis by enhancing bcsA mRNA levels (approximately sevenfold increase in mgtC mutants) and increasing c-di-GMP levels . Excessive cellulose production interferes with Salmonella replication inside macrophages, suggesting that proper atpF function helps balance energy utilization between virulence and biofilm formation.

A comparative analysis of these adaptation mechanisms demonstrates that the ATP synthase complex functions as a critical regulatory hub that integrates environmental signals (pH, magnesium levels) with metabolic responses to optimize bacterial survival during infection.

What experimental approaches can be used to assess the immunogenicity of recombinant Salmonella gallinarum vaccines expressing modified atpF?

Comprehensive immunogenicity assessment of recombinant S. gallinarum vaccines requires a multi-parameter approach:

Humoral immune response evaluation:

  • Plasma IgG measurement via ELISA: Detects systemic antibody responses against specific S. gallinarum antigens

  • Intestinal secretory IgA (sIgA) quantification: Critical for evaluating mucosal immunity, which is particularly important for orally administered vaccines

  • Western blot analysis: Confirms antibody specificity against particular bacterial proteins including atpF

Cell-mediated immune response assessment:

  • Lymphocyte proliferation assay: Measures T-cell responses to specific antigens

  • Cytokine profiling: Quantifies production of IFN-γ, IL-2, IL-4, and IL-10 to characterize Th1/Th2 balance

  • Flow cytometry: Identifies specific T-cell subsets activated following vaccination

Protection efficacy testing:

  • Challenge studies with wild-type S. gallinarum: Vaccinated chickens are challenged with virulent strains and monitored for clinical signs, mortality rates, and organ colonization

  • Bacterial recovery from tissues: Quantification of bacterial loads in liver and spleen to assess protection level

  • Lesion scoring: Evaluation of pathological changes in affected organs

Comparative studies with commercial vaccines:
Research has demonstrated that while there may be no significant differences in increases in body weight, cell-mediated immune responses, or systemic IgG responses between novel vaccine candidates and commercial SG 9R vaccines, significant elevations in intestinal sIgA have been observed at 3 weeks post-prime-immunization and 3 weeks post-boost-immunization with recombinant vaccines .

Safety assessment parameters:

  • Impact on body weight gain

  • Egg production rates in layer chickens

  • Bacteriological egg contamination analysis

  • Environmental shedding of the vaccine strain

For example, a study evaluating a lon/cpxR/asd deletion mutant of S. gallinarum expressing LTB found that the vaccinated group had significantly lower mortality (4% compared to 46% in controls) and lower lesion scores in liver and spleen when challenged with wild-type S. gallinarum .

What bioinformatic tools and approaches are most useful for analyzing atpF sequence variation across Salmonella strains?

Bioinformatic analysis of atpF sequence variation requires a systematic approach using multiple complementary tools:

Sequence retrieval and database mining:

  • NCBI Protein and Nucleotide databases: Primary sources for atpF sequences

  • UniProt: Provides curated protein information, including the Salmonella gallinarum atpF sequence (UniProt ID: B5RFV9)

  • Pathogen-specific databases: Include specialized repositories for Salmonella genomic data

Multiple sequence alignment tools:

  • MUSCLE or CLUSTAL Omega: For alignment of atpF sequences across different Salmonella strains

  • T-Coffee: Particularly useful for detecting conserved structural motifs

  • MAFFT: Efficient for large-scale alignments when comparing numerous strains

Phylogenetic analysis:

  • Maximum Likelihood methods (RAxML, PhyML)

  • Bayesian inference approaches (MrBayes)

  • Neighbor-Joining algorithms for quick preliminary analyses

Structural prediction and analysis:

  • SWISS-MODEL: For homology modeling of atpF tertiary structure

  • PyMOL: Visualization of structural features and mapping of sequence variations

  • TMHMM/HMMTOP: Prediction of transmembrane regions in atpF

Selection pressure analysis:

  • PAML (codeml): Detection of positive or negative selection on specific codons

  • HyPhy: Identification of sites under episodic selection

  • MEGA: Calculation of dN/dS ratios to assess selection intensity

Functional impact prediction:

  • SIFT/PolyPhen-2: Prediction of the functional impact of amino acid substitutions

  • ConSurf: Identification of functionally important residues based on evolutionary conservation

Comparative genomic approaches:

  • Mauve or ACT: Visualization of synteny and genomic context of atpF

  • PanOCT: Pan-genome analysis to identify core and accessory atpF variants

Research utilizing these approaches has revealed that while ATP synthase components are generally conserved across bacterial species, specific variations in key residues can affect interactions with virulence factors like MgtC, which binds to the a subunit of the F1Fo ATP synthase , potentially impacting pathogenicity.

What are the best experimental designs to study the role of atpF in biofilm formation and cellulose production?

Studying atpF's role in biofilm formation and cellulose production requires sophisticated experimental designs that link ATP synthase function to downstream regulatory pathways:

ATP level manipulation strategies:

  • Genetic approaches: Construction of atpF point mutants with altered function rather than complete deletions

  • Chemical approaches: Use of ATP synthase inhibitors at sub-lethal concentrations

  • Expression tuning: Placing atpF under inducible promoters with variable expression levels

Biofilm quantification methods:

  • Crystal violet staining: Quantifies total biofilm biomass

  • Confocal laser scanning microscopy: Visualizes biofilm architecture and matrix components

  • Flow cell systems: Enables real-time monitoring of biofilm development

Cellulose detection and quantification:

  • Calcofluor white staining: Specific for β-1,4-linked polysaccharides like cellulose

  • Congo red binding assays: Distinguishes between curli and cellulose production

  • Enzymatic digestion with cellulase followed by glucose quantification

c-di-GMP signaling assessment:

  • Reporter systems: The Vc2 riboswitch from Vibrio cholerae fused to a promoterless lacZ gene serves as an effective reporter where β-galactosidase activity is inversely proportional to c-di-GMP levels

  • Direct c-di-GMP quantification: Using LC-MS/MS methods

  • Genetic manipulation of c-di-GMP metabolism: Through deletion or overexpression of diguanylate cyclases and phosphodiesterases

Transcriptional regulation studies:

  • qRT-PCR analysis of cellulose synthase gene expression: Research has shown that inactivation of the mgtC gene resulted in a sevenfold increase in bcsA mRNA levels

  • RNA-Seq: For genome-wide transcriptional responses

  • Transcriptional fusions: Linking cellulose synthase promoters to reporter genes

Experimental controls and validation:

  • Complementation studies: Expressing wild-type atpF in mutant strains to confirm phenotype specificity

  • bcsA deletion controls: Essential to confirm that observed phenotypes are cellulose-dependent

  • Plasmid expressing F1 subunit genes: Used to demonstrate that ATP level modulation affects cellulose production independent of atpF genetic modifications

Intramacrophage cellulose production assessment:

  • Engineered strains with the macrophage-activated phoP promoter fused to a promoterless adrA gene (encoding a c-di-GMP synthase) can be used to induce cellulose production specifically inside macrophages

  • Fluorescent cellulose-binding proteins for microscopic visualization

  • Comparative analysis between wild-type and bcsA mutants to confirm cellulose-dependent effects on intracellular replication

What is the impact of atpF manipulation on Salmonella gallinarum virulence and vaccine efficacy?

The table below summarizes research findings on the impact of atpF and ATP synthase manipulation on Salmonella virulence and vaccine efficacy:

Genetic ModificationImpact on ATP SynthaseVirulence PhenotypeVaccine EfficacyReference
Wild-typeNormal functionFull virulenceN/A
mgtC deletionIncreased ATP levels (~2.2-fold)Attenuated in macrophagesN/A
F1 subunit overexpressionIncreased ATPase activityReduced growth in low Mg²⁺N/A
atpB deletionLoss of a subunit functionHighly attenuatedN/A
atpB mgtC double deletionLoss of a subunit functionSimilar to atpB single deletionN/A
bcsA deletionNormal ATP synthase, reduced celluloseEnhanced macrophage replicationN/A
bcsA mgtC double deletionIncreased ATP levels, no celluloseBetter than wild-type and mgtC single mutant in macrophagesN/A
lon/cpxR/asd deletion + LTB expressionAltered ATP synthase regulationHighly attenuated96% protection vs 46% mortality in controls
Arabinose-regulated rfaHAltered membrane composition affecting ATP synthaseControlled attenuationHigher antibody titers than parent attenuated strain
phoPQ deletionAltered ATP synthase regulation via MgtCNon-pathogenic via oral routeDiscreet to moderate protection

Research demonstrates that atpF manipulation has profound impacts on both virulence and vaccine potential. Studies show that proper modulation of ATP synthase function can create balanced attenuation that maintains immunogenicity while eliminating pathogenicity, which is crucial for effective vaccine development .

What comparative data exists on immune responses generated by different Salmonella gallinarum vaccine formulations?

The following table compares immune responses elicited by different S. gallinarum vaccine formulations:

Vaccine FormulationSystemic IgG ResponseIntestinal sIgACell-Mediated ResponseProtection Against ChallengeReference
SG 9R (commercial)ModerateNot significantly elevated vs controlModerateModerate protection
SG JOL916 (lon/cpxR deletion)ModerateModerateModerateSignificant reduction in mortality
SG JOL916 + JOL1229 (LTB adjuvant)HighSignificantly elevated at 3 weeks post-prime and post-boostHighSignificant reduction in mortality
SG JOL1355 (lon/cpxR/asd + LTB)HighHighNot reported96% survival vs 54% in controls
SG ΔphoPQLow when administered orallyLowNot reportedNon-pathogenic (oral), moderate (subcutaneous)
SG102 (expressing APEC type I fimbriae)Cross-protective against APECEnhanced mucosal immunityCross-reactiveProtection against both S. gallinarum and APEC

The data reveals that recombinant vaccine formulations incorporating adjuvants like LTB or expressing additional antigenic determinants generate superior immune responses compared to traditional attenuated vaccines. Notably, the JOL916 + JOL1229 combination demonstrated significantly elevated intestinal sIgA at 3 weeks post-prime-immunization and 3 weeks post-boost-immunization, while sIgA levels in SG 9R-immunized chickens were not significantly elevated compared to the control .

How does ATP synthase function correlate with bacterial adaptation to different environmental conditions?

This table presents the relationship between ATP synthase function and Salmonella adaptation to various environmental conditions:

Environmental ConditionATP Synthase ResponseBacterial Adaptation MechanismPhysiological OutcomeReference
Low Mg²⁺Reduced ATP levels via MgtCATP levels maintained at ~45% of mgtC mutantRestored growth in limiting Mg²⁺
Acidic pH (phagosome)MgtC inhibits ATP synthaseMaintenance of cytoplasmic pHEnhanced intracellular survival
Nutrient limitationAltered F1Fo ATP synthase activityBalanced energy production/consumptionPersistent infection
High c-di-GMP levelsIncreased cellulose productionBiofilm formationReduced intracellular replication
Macrophage environmentMgtC interaction with a subunitReduced ATP levels, controlled cellulose productionEnhanced pathogen persistence
Antimicrobial peptide exposureMembrane composition changes affecting ATP synthaseAltered proton gradient maintenanceIncreased resistance

Research demonstrates that ATP synthase function, including the role of atpF, serves as a critical regulatory hub that integrates environmental signals with metabolic responses. For example, MgtC's interaction with the ATP synthase helps maintain approximately 2.2-fold lower ATP levels in wild-type Salmonella compared to mgtC mutants, which correlates with more stable cytoplasmic pH regulation and enhanced intracellular survival .

What are emerging approaches for using recombinant Salmonella gallinarum ATP synthase components in vaccine development?

Several innovative approaches are emerging for utilizing recombinant S. gallinarum ATP synthase components in next-generation vaccine development:

Structure-guided attenuation: Advanced structural biology techniques such as cryo-electron microscopy are enabling precise mapping of ATP synthase complexes. This structural information allows for rational design of attenuation strategies that target specific functional domains of atpF without compromising immunogenicity .

ATP synthase-based adjuvant platforms: Research suggests that ATP synthase components could serve as molecular scaffolds for presenting multiple heterologous antigens. By creating fusion proteins between atpF and antigenic determinants from other avian pathogens, multi-valent vaccines with enhanced immunogenicity can be developed .

Regulated energy metabolism: Advanced genetic circuits that dynamically regulate atpF expression in response to specific in vivo environments could create vaccines that are fully immunogenic during initial colonization but become increasingly attenuated during infection .

Cross-protective epitope presentation: Identification of conserved epitopes within atpF across different Salmonella serovars offers the potential for developing cross-protective vaccines effective against multiple Salmonella strains simultaneously .

Combined deletion strategies: Research has shown that combining ATP synthase modifications with alterations in other virulence pathways, such as the phoPQ two-component system, can generate highly attenuated strains with robust immunogenicity profiles .

Metabolic engineering approaches: By fine-tuning the ATP synthase function to alter the metabolic state of the vaccine strain, researchers can potentially influence antigen presentation and immune response development without directly modifying antigenic components .

The integration of these approaches with systems biology and immunoinformatics tools holds promise for developing highly effective vaccines that provide robust protection against fowl typhoid while maintaining excellent safety profiles.

How might further understanding of atpF interactions with virulence factors lead to novel therapeutic approaches?

Deeper insights into atpF interactions with virulence factors could pioneer several innovative therapeutic strategies:

Targeted inhibitor development: The elucidation of the molecular interface between MgtC and the ATP synthase complex creates opportunities for developing small molecule inhibitors that could either:

  • Block this interaction to prevent Salmonella adaptation within macrophages

  • Mimic the interaction to artificially attenuate virulent strains in vivo

Pathogen-specific ATP synthase inhibitors: Unlike conventional antibiotics that target conserved bacterial processes, the unique interactions between virulence factors and ATP synthase components could allow for the development of pathogen-specific inhibitors that do not affect commensal bacteria .

Combination therapies: Understanding how ATP synthase modulation affects other virulence mechanisms could inform rational combination therapies that simultaneously target multiple aspects of bacterial pathogenesis. For example, combining ATP synthase inhibitors with drugs targeting cellulose production pathways might create synergistic antimicrobial effects .

Host-directed therapeutic approaches: Since ATP synthase function is linked to adaptation to host environments, compounds that alter the host cellular environment to make it less conducive to these adaptations could represent a novel therapeutic avenue that is less prone to resistance development.

Biofilm dispersal agents: The link between ATP levels, c-di-GMP signaling, and biofilm formation suggests that compounds targeting ATP synthase could serve as biofilm dispersal agents, potentially enhancing the efficacy of conventional antibiotics against biofilm-protected infections .

Virulence-targeted antibiotics: Rather than killing bacteria outright, compounds that specifically inhibit interactions between virulence factors and ATP synthase components could create "disarmed" pathogens that can be more easily cleared by the host immune system while reducing selective pressure for resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.