Recombinant Salmonella gallinarum ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Production and Handling

The recombinant protein is manufactured under controlled conditions to ensure high purity and stability:

ParameterSpecification
Purity>90% (SDS-PAGE confirmed)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional 5–50% glycerol
StabilityAvoid repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week

Functional Role in ATP Synthase and Pathogenesis

Subunit c is integral to the F₁F₀ ATP synthase, which operates reversibly:

  • ATP Synthesis: In energy-replete conditions, proton gradient-driven rotation of the F₀ subunits (including subunit c) drives ATP production via F₁ subunits .

  • Proton Translocation: Subunit c facilitates proton movement across the membrane, critical for maintaining membrane potential .

In Salmonella, the ATP synthase is regulated by virulence factors like MgtC, which binds the a subunit of F₀ to inhibit proton translocation and ATP synthesis. This modulation:

  • Maintains Cytoplasmic pH: Prevents acidification during phagocytosis by macrophages .

  • Reduces ATP Levels: Low ATP suppresses cyclic diguanylate (c-di-GMP), a secondary messenger that promotes biofilm formation (e.g., cellulose synthesis) .

Virulence Studies

The recombinant atpE protein is used to study ATP synthase inhibition by MgtC. Mutations in mgtC or atpB (encoding subunit a) disrupt ATP levels and intracellular pH, impairing Salmonella survival in macrophages .

Diagnostic and Vaccine Development

  • ELISA Kits: Recombinant atpE is utilized in enzyme-linked immunosorbent assays to detect anti-atpE antibodies, aiding in serological studies .

  • Vaccine Platforms: While not directly linked to atpE, Salmonella gallinarum strains modified to express heterologous antigens (e.g., APEC type I fimbriae) are explored as vaccine vectors, leveraging their avirulence and immunogenicity .

Comparative Analysis with Homologs

OrganismUniProt IDKey Differences
Salmonella gallinarumB5RFV8Full-length (1–79 aa), His-tagged, expressed in E. coli
Salmonella typhimuriumSimilar F₀ subunit c structure; recombinant forms available for research
Escherichia coliSubunit c homologs (e.g., atpE) share conserved proton channel motifs

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
atpE; SG3563; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-79
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
atpE
Target Protein Sequence
MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the F(0) channel, directly involved in translocation across the membrane. A homomeric c-ring composed of 10-14 subunits forms the central stalk rotor element, interacting with the F(1) delta and epsilon subunits.
Database Links

KEGG: seg:SG3563

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.