Recombinant Salmonella gallinarum Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; SG2919; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
aas
Target Protein Sequence
MLFGFFRNLFRVLYRVRVTGDVRALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRAVVIFPEGRISVTGSLMKIYDG AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPPTQIPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCIEDINFTPDTYRKLLTK TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV KQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETERGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKGEALVLFT TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE
Uniprot No.

Target Background

Function

Recombinant Salmonella gallinarum Bifunctional protein aas (aas) plays a crucial role in lysophospholipid acylation. It catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links

KEGG: seg:SG2919

Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the bifunctional protein Aas in Salmonella gallinarum?

The Aas protein in Salmonella gallinarum is a bifunctional enzyme that exhibits both 2-acyl-glycerophosphoethanolamine (2-acyl-GPE) acyltransferase and acyl-acyl carrier protein (acyl-ACP) synthetase activities. These dual enzymatic functions play critical roles in phospholipid metabolism and fatty acid utilization within the bacterial cell. The full-length protein consists of 719 amino acids and is encoded by the aas gene. The primary function of Aas in bacterial metabolism is to act as a salvage pathway for the resynthesis of phosphatidylethanolamine from 2-acyl-GPE, which may originate from either the extracellular environment or internal phospholipid turnover . This bifunctional nature makes Aas an interesting target for biochemical and structural studies in understanding bacterial lipid metabolism.

How does the conserved histidine residue (H36) contribute to the acyltransferase activity of Aas?

The conserved histidine residue (H36) in the Aas protein plays a crucial role specifically in the acyltransferase activity. Site-directed mutagenesis studies have demonstrated that the H36A mutant completely lacks acyltransferase activity while retaining significant acyl-ACP synthetase activity. This finding illustrates that the histidine residue is selectively essential for the acyltransferase function of the protein .

Mechanistically, the conserved histidine functions as a general base to deprotonate the hydroxyl moiety of the acyl acceptor during the acyltransferase reaction. This histidine is part of a highly conserved HX₄D motif found in many glycerolipid acyltransferases. The specific position and chemical properties of histidine make it ideal for this catalytic role, as it can efficiently abstract a proton from the hydroxyl group, facilitating nucleophilic attack on the acyl donor .

Experimental evidence supporting this role comes from comparative studies with other acyltransferases, including the sn-glycerol-3-phosphate acyltransferase (PlsB) of Escherichia coli, where mutation of the corresponding histidine (H306) similarly eliminated acyltransferase activity. The selective impact on acyltransferase function without affecting synthetase activity provides strong evidence for the direct catalytic role of this residue rather than a general structural function .

What is the significance of the HX₄D motif in Aas protein function?

The HX₄D motif (histidine followed by any four amino acids and then an aspartic acid) represents a critical structural and functional element in the Aas protein and other glycerolipid acyltransferases. This highly conserved motif forms the catalytic core essential for acyltransferase activity. The significance of this motif extends beyond just the histidine residue discussed previously:

  • The invariant aspartic acid in the HX₄D pattern is also crucial for proper function. Studies with the related PlsB protein showed that substituting aspartic acid 311 with glutamic acid significantly reduced catalytic activity, while replacement with alanine completely eliminated acyltransferase activity .

  • The aspartic acid residue serves dual roles: it participates in the catalytic mechanism and is important for proper protein folding and membrane insertion. When aspartic acid was replaced with alanine in PlsB (D311A), the resulting protein failed to properly assemble into the membrane, indicating its structural importance .

  • The four amino acids between the histidine and aspartic acid create critical spacing that positions these catalytic residues optimally within the active site.

For researchers investigating Aas function, any experimental manipulations of this motif should be approached with caution, as they may affect not only catalytic activity but also protein stability and membrane integration. The dual impact of mutations in this region makes it a particularly interesting target for structure-function studies but requires careful experimental design to distinguish between catalytic and structural effects.

What expression systems are most effective for producing functional recombinant Aas protein?

For obtaining functional recombinant Salmonella gallinarum Aas protein, E. coli-based expression systems have proven effective, particularly when the protein is fused to an affinity tag such as a His-tag for purification purposes. Based on current protocols, the following approach is recommended:

  • Expression Host: E. coli is the preferred expression host for recombinant Aas protein production. Studies have successfully used E. coli to express the full-length (1-719 amino acids) Aas protein while maintaining its functional properties .

  • Affinity Tags: N-terminal His-tagging has been demonstrated to facilitate purification without compromising the bifunctional activities of the protein. The His-tag allows for single-step purification using nickel affinity chromatography .

  • Expression Vector Selection: Vectors with tightly regulated promoters are recommended since membrane-associated proteins like Aas may be toxic when overexpressed. Inducible systems such as T7 or tac promoters allow for controlled expression.

  • Induction Conditions: Lower induction temperatures (16-20°C) and reduced inducer concentrations often improve the yield of correctly folded, active membrane-associated proteins like Aas.

  • Membrane Fraction Handling: Since Aas is a membrane-associated protein, proper membrane fraction isolation and handling are critical for retaining activity. Gentle detergent solubilization is typically required to maintain the native conformation and activity.

When designing expression constructs, researchers should consider that the bifunctional nature of Aas requires proper folding of two distinct catalytic domains. Experimental verification of both acyltransferase and acyl-ACP synthetase activities is essential to confirm that the recombinant protein retains its full functionality after expression and purification.

How should recombinant Aas protein be stored to maintain activity?

Proper storage of recombinant Salmonella gallinarum Aas protein is critical for maintaining its dual enzymatic activities. Based on empirical data and established protocols, the following storage recommendations should be followed:

  • Short-term Storage: For working aliquots, store at 4°C for up to one week. This minimizes freeze-thaw cycles while providing convenient access for ongoing experiments .

  • Long-term Storage: Store the purified protein at -20°C or preferably -80°C. The protein should be stored in aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce enzymatic activity .

  • Storage Buffer Composition: A Tris/PBS-based buffer with pH 8.0 containing 6% trehalose has been shown to effectively stabilize the protein during storage. The slightly alkaline pH helps maintain the protein's native conformation .

  • Cryoprotectant Addition: The addition of glycerol to a final concentration of 30-50% is strongly recommended for long-term storage. This prevents ice crystal formation that can denature the protein structure. The recommended default concentration is 50% glycerol .

  • Lyophilization Option: For very long-term storage, lyophilization (freeze-drying) can be effective. The lyophilized powder should be stored at -20°C/-80°C and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL when needed .

  • Reconstitution Protocol: Prior to opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, it's advisable to add glycerol (5-50% final concentration) and prepare small aliquots before freezing at -20°C/-80°C .

  • Activity Monitoring: Periodic testing of both enzymatic activities is recommended for stocks stored longer than 3 months to ensure the protein remains functional.

These storage conditions have been optimized to preserve both the acyltransferase and acyl-ACP synthetase activities of the bifunctional Aas protein. Researchers should note that the membrane-associated nature of the protein makes it particularly sensitive to storage conditions compared to soluble proteins.

How can researchers effectively design mutations to study the dual functionality of Aas?

To effectively study the dual functionality of the Aas protein through mutation analysis, researchers should implement a strategic approach that distinguishes between the protein's acyltransferase and acyl-ACP synthetase activities. Based on previous successful studies, the following methodology is recommended:

  • Targeted Mutation of Catalytic Residues:

    • Focus on the conserved HX₄D motif, particularly the invariant histidine (H36), which has been demonstrated to be essential specifically for acyltransferase activity without affecting synthetase function .

    • Create the H36A substitution as a positive control, as this mutation is known to eliminate acyltransferase activity while preserving acyl-ACP synthetase activity .

    • Consider mutations in the aspartic acid residue of the HX₄D motif, but be aware that these may affect protein folding and membrane insertion in addition to catalytic function .

  • Domain-Specific Mutations:

    • Map the distinct domains responsible for each activity through sequence alignment with homologous proteins of known function.

    • Design mutations in residues predicted to be specifically involved in substrate binding for each function.

    • Create chimeric proteins by swapping domains with related single-function enzymes to delineate the structural requirements for each activity.

  • Assay Development for Functional Separation:

    • Establish independent assays for measuring each activity separately:

      • For acyltransferase activity: Monitor the transfer of acyl groups to glycerophosphoethanolamine using radiolabeled substrates or coupled enzymatic assays.

      • For acyl-ACP synthetase activity: Measure the ATP-dependent formation of acyl-ACP using gel shift assays or fluorescent ACP derivatives.

  • Substrate Specificity Analysis:

    • Test mutations that alter the substrate binding pocket to modify specificity for different fatty acids or acceptor molecules.

    • Examine whether alterations in substrate specificity for one activity impact the other function.

  • Structural Considerations:

    • Use molecular modeling based on related proteins with known structures to predict the impact of mutations.

    • Consider the membrane association of the protein when designing mutations, as this may affect proper folding and activity.

This systematic approach allows researchers to dissect the structural basis for the dual functionality of Aas and potentially engineer variants with enhanced or modified activities for biotechnological applications.

What is the role of Aas in Salmonella gallinarum pathogenicity?

While direct evidence specifically linking Aas to Salmonella gallinarum pathogenicity is limited in the provided search results, we can make informed assessments based on the protein's function and related studies in bacterial pathogenesis:

The Aas protein likely contributes to S. gallinarum pathogenicity through several mechanisms:

  • Membrane Homeostasis During Infection: As a bifunctional enzyme involved in phospholipid metabolism, Aas plays a crucial role in maintaining membrane integrity during the stress conditions encountered within host cells. S. gallinarum causes fowl typhoid, a severe systemic infection in poultry with high mortality rates , and bacterial membrane adaptation is essential during dissemination to systemic organs.

  • Phospholipid Recycling During Host Colonization: The acyltransferase activity of Aas facilitates the recycling of 2-acyl-GPE into phosphatidylethanolamine, a major membrane phospholipid. This salvage pathway would be particularly important during infection when the bacterium may face phospholipid precursor limitations or membrane damage from host defense mechanisms .

  • Fatty Acid Utilization in Nutrient-Limited Environments: The acyl-ACP synthetase activity allows S. gallinarum to activate and incorporate exogenous fatty acids, potentially including those scavenged from the host. This ability to utilize host-derived fatty acids could provide a metabolic advantage during infection.

  • Potential Resistance to Host Antimicrobial Compounds: Properly functioning membrane homeostasis mechanisms are critical for resistance to host antimicrobial compounds that target bacterial membranes. The wecB gene mutant of S. gallinarum showed lower resistance to bile acid and nalidixic acid , suggesting that membrane composition and integrity genes (potentially including aas) could affect antimicrobial resistance.

  • Contribution to Systemic Spread: S. gallinarum typically causes a systemic infection, with bacteria rapidly disseminating to organs like the liver and spleen . Membrane adaptation through Aas-mediated phospholipid recycling could support this systemic spread by facilitating survival in different host environments.

For researchers investigating the specific role of Aas in S. gallinarum pathogenicity, targeted gene deletion studies similar to those conducted for the wecB gene would be informative, particularly examining the impact on systemic dissemination, organ colonization, and survival under various stress conditions relevant to the infection process.

What assays can be used to measure the two distinct activities of the Aas protein?

Measuring the dual enzymatic activities of the Aas protein requires distinct assay systems for each function. The following methodologies are recommended based on established biochemical techniques:

Acyltransferase Activity Assays:

  • Radiolabeled Substrate Assay:

    • Incubate the purified Aas protein with radiolabeled acyl donors (e.g., [¹⁴C]- or [³H]-labeled acyl-ACP or acyl-CoA) and 2-acyl-GPE acceptor substrates.

    • After the reaction, separate the products using thin-layer chromatography (TLC) or liquid chromatography.

    • Quantify the formation of radiolabeled phosphatidylethanolamine by scintillation counting.

    • This method provides high sensitivity for detecting acyltransferase activity.

  • HPLC-Based Assay:

    • Measure the disappearance of substrate or appearance of product using HPLC with appropriate detection methods (UV, fluorescence, or mass spectrometry).

    • This approach avoids the need for radioactive materials but may require derivatization for enhanced detection.

  • Coupled Enzymatic Assay:

    • Design a system where the release of CoA or ACP during the acyltransferase reaction is coupled to another enzyme that produces a measurable signal.

    • For example, the released CoA can be detected using 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB) in a spectrophotometric assay.

Acyl-ACP Synthetase Activity Assays:

  • ATP Consumption Assay:

    • Measure ATP consumption during the activation of fatty acids to acyl-ACP using coupled enzyme systems (e.g., pyruvate kinase and lactate dehydrogenase) that link ATP hydrolysis to NADH oxidation.

    • Monitor the decrease in NADH fluorescence or absorbance at 340 nm.

  • Acyl-ACP Formation Assay:

    • Use conformationally sensitive gel electrophoresis to separate acyl-ACP from unmodified ACP.

    • The migration difference between acylated and non-acylated ACP allows quantification of synthetase activity.

    • This can be enhanced using fluorescently labeled ACP for increased sensitivity.

  • Pyrophosphate Release Assay:

    • Measure the release of pyrophosphate during the acyl-ACP synthetase reaction using enzymatic coupling with inorganic pyrophosphatase and other detection systems.

Controls and Validation:

To ensure the specificity and reliability of these assays, researchers should:

  • Include the H36A mutant as a control, which should show defective acyltransferase activity but retain acyl-ACP synthetase activity .

  • Use appropriate enzyme concentration and time course studies to ensure linearity of the reaction.

  • Vary substrate concentrations to determine kinetic parameters (Km and Vmax) for both activities.

These carefully designed assay systems will allow researchers to accurately measure and characterize both enzymatic activities of the Aas protein, facilitating structure-function studies and potential applications in biotechnology.

How can researchers optimize the purification of active Aas protein?

Purifying bifunctional membrane-associated proteins like Aas while maintaining both enzymatic activities presents significant challenges. The following optimized protocol incorporates strategies to overcome these challenges:

Purification Protocol Optimization:

  • Membrane Extraction:

    • After cell lysis, carefully isolate the membrane fraction through differential centrifugation (typically 100,000 × g for 1 hour).

    • Wash membrane pellets with buffer containing low salt concentrations to remove loosely associated proteins while retaining membrane-integrated Aas.

  • Detergent Selection and Solubilization:

    • Test multiple detergents in small-scale trials before large-scale purification.

    • Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS at concentrations just above their critical micelle concentration (CMC) often effectively solubilize membrane proteins while preserving activity.

    • Solubilize membranes by gentle agitation at 4°C for 1-2 hours.

  • Affinity Chromatography Optimization:

    • For His-tagged Aas protein, use immobilized metal affinity chromatography (IMAC) with Ni-NTA or TALON resins .

    • Include low concentrations of detergent in all chromatography buffers (typically 2-3× the CMC).

    • Consider adding phospholipids (0.01-0.05% w/v) to stabilize the protein during purification.

    • Use gradient elution with imidazole to improve purity while minimizing exposure to high imidazole concentrations.

  • Additional Purification Steps:

    • If higher purity is required, consider ion exchange chromatography or size exclusion chromatography as secondary purification steps.

    • For size exclusion, use columns equilibrated with buffer containing detergent and potentially phospholipids.

Activity Preservation Strategies:

  • Buffer Optimization:

    • Maintain slightly alkaline pH (7.5-8.0) throughout purification.

    • Include glycerol (10-20%) to stabilize the protein.

    • Add reducing agents such as DTT or β-mercaptoethanol (1-5 mM) to prevent oxidation of critical cysteine residues.

  • Temperature Control:

    • Perform all purification steps at 4°C to minimize protein denaturation and proteolysis.

    • Avoid freeze-thaw cycles; if needed, flash-freeze in liquid nitrogen and store at -80°C.

  • Protease Inhibition:

    • Include a cocktail of protease inhibitors during cell lysis and initial purification steps.

    • Consider using EDTA (for metalloproteases) in buffers prior to IMAC, then remove before applying to metal-containing resins.

  • Reconstitution Considerations:

    • For maximum activity, consider reconstituting the purified protein into liposomes or nanodiscs composed of E. coli phospholipids.

    • For storage, lyophilized powder formats have been shown to maintain stability when properly reconstituted .

Quality Control:

  • Activity Assays: Test both enzymatic activities using the assays described in section 5.1 after each purification step to track activity recovery.

  • Protein Purity Assessment: Use SDS-PAGE with Coomassie or silver staining and potentially Western blotting to confirm purity and identity.

  • Stability Monitoring: Assess protein stability by dynamic light scattering or thermal shift assays to optimize buffer conditions.

By implementing these strategies, researchers can optimize the purification of active Aas protein while maintaining both its acyltransferase and acyl-ACP synthetase activities for subsequent structural and functional studies.

How does S. gallinarum Aas compare to homologous proteins in other bacterial species?

The Aas protein from Salmonella gallinarum shares significant structural and functional similarities with homologous proteins in other bacterial species, particularly within the Enterobacteriaceae family. This comparative analysis provides valuable insights into evolutionary conservation and specialization:

Comparison with E. coli Aas:

The most well-characterized homolog is the Aas protein from Escherichia coli, which has been subjected to detailed biochemical and genetic analysis:

  • Sequence Conservation: High sequence similarity exists between S. gallinarum and E. coli Aas proteins, particularly in catalytic domains. Both proteins maintain the critical HX₄D motif essential for acyltransferase activity .

  • Functional Conservation: Like the S. gallinarum protein, E. coli Aas exhibits bifunctional activity, serving as both a 2-acyl-GPE acyltransferase and an acyl-ACP synthetase .

  • Physiological Role: In both organisms, Aas functions primarily as a salvage pathway for phosphatidylethanolamine biosynthesis from 2-acyl-GPE obtained from the environment or generated by phospholipase activity .

  • Catalytic Mechanism: Mutagenesis studies in E. coli Aas revealed that the conserved histidine (H36) functions as a general base to deprotonate the hydroxyl moiety of the acyl acceptor during the acyltransferase reaction. This mechanism is likely conserved in S. gallinarum Aas .

Evolutionary Conservation Across Bacterial Species:

  • Domain Architecture: The bifunctional nature of Aas with distinct domains for acyltransferase and synthetase activities is conserved across many gram-negative bacteria, suggesting an ancient gene fusion event that provided selective advantages.

  • Catalytic Residues: The HX₄D motif is highly conserved across bacterial acyltransferases, including not only Aas proteins but also other glycerolipid acyltransferases like PlsB (sn-glycerol-3-phosphate acyltransferase) . This conservation highlights the fundamental importance of this catalytic mechanism in bacterial lipid metabolism.

  • Membrane Association: Across species, Aas proteins maintain their association with the bacterial membrane, reflecting their role in phospholipid metabolism and membrane homeostasis.

Species-Specific Adaptations:

While core functions are conserved, subtle differences may exist in:

  • Substrate Specificity: Different bacterial species may show variations in fatty acid preferences for both the acyltransferase and synthetase activities, potentially reflecting adaptation to different ecological niches.

  • Regulation: Expression patterns and regulatory mechanisms may differ between species, particularly between host-specific pathogens like S. gallinarum and more generalist bacteria like E. coli.

  • Pathogenic Context: In host-adapted pathogens like S. gallinarum, which causes severe systemic infections in poultry , Aas may have evolved specific properties that contribute to survival within the host environment, though direct evidence for this specialization is currently limited.

This comparative perspective provides valuable context for researchers studying S. gallinarum Aas, allowing them to leverage findings from better-characterized homologs while remaining alert to potential species-specific adaptations that may be relevant to S. gallinarum's unique pathogenic lifestyle.

What are the potential applications of Aas protein in developing novel antimicrobials against S. gallinarum?

The bifunctional Aas protein presents several promising avenues for antimicrobial development against Salmonella gallinarum, a significant poultry pathogen causing fowl typhoid with high economic impact . Based on its structural features and essential metabolic functions, the following research directions merit exploration:

Aas as a Direct Drug Target:

  • Acyltransferase Domain Inhibitors:

    • The conserved HX₄D motif represents a specific target for small molecule inhibitor design .

    • Structural analogs of the transition state during acyl transfer could serve as competitive inhibitors.

    • High-throughput screening of compound libraries against the acyltransferase activity could identify lead compounds that selectively inhibit this essential function.

  • Dual-Activity Inhibitors:

    • Compounds targeting both enzymatic activities simultaneously would potentially reduce the likelihood of resistance development.

    • The unique bifunctional nature of Aas offers an opportunity to design inhibitors that would not affect host enzymes, which typically separate these functions.

  • Allosteric Modulators:

    • Identification of allosteric sites that affect the coordination between the two catalytic domains could lead to novel inhibitor classes that disrupt the protein's bifunctionality.

Structure-Based Drug Design Opportunities:

  • Rational Design Strategy:

    • Though full crystal structures are not currently available, homology modeling based on related proteins could guide rational drug design efforts.

    • Virtual screening approaches focusing on the catalytic pockets of both enzymatic domains could identify candidate inhibitors for experimental validation.

  • Fragment-Based Approach:

    • A fragment-based drug discovery approach could identify small chemical entities that bind to different regions of the Aas protein, which could then be linked to create high-affinity inhibitors.

Alternative Approaches Leveraging Aas Biology:

  • Membrane Permeabilizers:

    • Since Aas is involved in phospholipid metabolism and membrane maintenance, compounds that interfere with its function could potentially increase bacterial membrane permeability, enhancing the efficacy of existing antibiotics.

  • Anti-virulence Strategy:

    • If Aas contributes to S. gallinarum virulence during systemic infection, inhibitors might reduce pathogenicity without directly killing bacteria, potentially reducing selection pressure for resistance.

  • Vaccine Development:

    • Recombinant Aas protein could potentially serve as an antigen in subunit vaccine formulations against S. gallinarum, similar to how other S. gallinarum proteins have been explored for vaccine development .

Methodological Considerations for Antimicrobial Development:

  • Screening System Development:

    • Establish high-throughput assay systems for both Aas activities that are amenable to large-scale compound screening.

    • Develop whole-cell screening approaches using sensitized S. gallinarum strains with reduced Aas expression to identify compounds with enhanced activity against this target.

  • Resistance Analysis:

    • Study potential resistance mechanisms that might emerge against Aas inhibitors.

    • Evaluate the fitness cost of resistance mutations in the Aas protein to assess the sustainability of this targeting approach.

  • Delivery System Considerations:

    • For poultry applications, develop appropriate delivery systems for Aas inhibitors, such as feed additives or water-soluble formulations.

These research directions would benefit from collaborative approaches combining structural biology, medicinal chemistry, and veterinary microbiology to advance the development of novel antimicrobials targeting this bifunctional protein in S. gallinarum.

How might gene editing techniques be applied to study Aas function in S. gallinarum pathogenesis?

Modern gene editing techniques offer powerful approaches to precisely investigate the role of the Aas protein in Salmonella gallinarum pathogenesis. The following methodological framework outlines how researchers can apply these techniques effectively:

Experimental Validation Approaches:

  • In Vitro Phenotypic Characterization:

    • Assess membrane integrity using fluorescent dyes and permeability assays.

    • Evaluate resistance to antimicrobial compounds, particularly those targeting the bacterial membrane.

    • Examine growth under various stress conditions relevant to the host environment (e.g., bile salts, acidic pH, oxidative stress).

    • Similar to studies with wecB mutants, test resistance to bile acid and nalidixic acid .

  • Chicken Infection Models:

    • Oral infection model to evaluate the complete infection cycle.

    • Measure bacterial loads in systemic organs (liver, spleen) at various time points post-infection.

    • Assess clinical signs, mortality rates, and pathological changes in infected birds.

    • Quantify pro-inflammatory cytokine responses (IL-1β, TNF-α, CXCLi1) in infected tissues .

  • Cell Culture Infection Models:

    • Examine invasion and intracellular survival in chicken macrophages and epithelial cells.

    • Use fluorescently labeled bacteria to track subcellular localization during infection.

    • Measure host cell responses to infection with wild-type versus aas mutant strains.

Advanced Genetic Approaches:

  • Complementation Studies:

    • Reintroduce the wild-type aas gene or domain-specific mutants into deletion strains to confirm phenotypes are specifically due to Aas function.

    • Use complementation with homologs from other bacterial species to assess functional conservation.

  • Reporter Fusion Systems:

    • Create translational fusions with fluorescent proteins to monitor Aas expression and localization during infection.

    • Develop transcriptional reporters to examine regulation of aas expression in response to host environmental cues.

  • Suppressor Screens:

    • If aas mutation causes significant attenuation, perform suppressor screens to identify compensatory mutations that restore virulence, potentially revealing functional networks associated with Aas.

Multi-omics Integration:

  • Transcriptomics:

    • Compare gene expression profiles between wild-type and aas mutant strains during infection to identify downstream effects on virulence gene expression.

  • Metabolomics:

    • Analyze phospholipid profiles and fatty acid composition to assess the impact of aas mutation on membrane structure.

  • Proteomics:

    • Examine changes in membrane protein composition and abundance in aas mutants to understand broader impacts on cellular physiology.

By systematically applying these gene editing and analytical approaches, researchers can comprehensively elucidate the role of the Aas protein in S. gallinarum pathogenesis, potentially identifying new targets for intervention strategies against fowl typhoid.

What quality control measures should be implemented when working with recombinant Aas protein?

Ensuring the quality and consistency of recombinant Salmonella gallinarum Aas protein preparations is essential for reliable research outcomes. The following comprehensive quality control framework addresses the unique challenges associated with this bifunctional membrane-associated protein:

Purity Assessment:

  • SDS-PAGE Analysis:

    • Perform SDS-PAGE with Coomassie or silver staining to verify protein purity.

    • The recombinant full-length Aas protein (719 amino acids) with an N-terminal His-tag should appear at the expected molecular weight.

    • Aim for >90% purity as determined by densitometric analysis of stained gels .

  • Western Blot Verification:

    • Confirm protein identity using antibodies against the His-tag or, if available, Aas-specific antibodies.

    • This verifies that the observed protein band is indeed the recombinant Aas protein.

  • Mass Spectrometry:

    • Perform peptide mass fingerprinting or LC-MS/MS analysis to confirm protein identity and sequence integrity.

    • This can identify any truncations or modifications that might affect function.

Functional Activity Testing:

  • Dual Activity Assessment:

    • Test both acyltransferase and acyl-ACP synthetase activities using the assays described in section 5.1.

    • Establish specific activity benchmarks for quality control purposes.

    • Compare activity levels between different batches to ensure consistency.

  • Control Experiments:

    • Include positive controls (known active preparations) and negative controls (heat-inactivated enzyme) in activity assays.

    • If available, test the H36A mutant as a control that should lack acyltransferase activity but retain acyl-ACP synthetase activity .

  • Linearity Assessment:

    • Verify that enzyme activity is linear with respect to both enzyme concentration and time under your assay conditions.

    • Non-linearity could indicate problems with protein quality or assay conditions.

Physical Characterization:

  • Protein Concentration Determination:

    • Use multiple methods (Bradford/BCA assay, absorbance at 280 nm) to accurately determine protein concentration.

    • Account for potential interferents, particularly detergents used for membrane protein solubilization.

  • Thermal Stability Assessment:

    • Perform differential scanning fluorimetry (thermal shift assays) to evaluate protein stability.

    • Compare melting temperatures between batches as a quality indicator.

  • Aggregation Analysis:

    • Use dynamic light scattering or size exclusion chromatography to detect protein aggregation.

    • Membrane proteins like Aas are particularly prone to aggregation, which can affect activity.

Storage Validation:

  • Stability Testing:

    • Validate storage conditions by testing activity after storage at different temperatures for various durations.

    • Confirm that the recommended storage in Tris/PBS-based buffer with 6% trehalose at -20°C/-80°C maintains activity .

    • Verify that lyophilized preparations can be successfully reconstituted with full activity retention.

  • Freeze-Thaw Sensitivity:

    • Determine activity loss after multiple freeze-thaw cycles to establish handling guidelines.

    • Confirm the recommendation to avoid repeated freeze-thaw cycles .

  • Working Aliquot Testing:

    • Validate that working aliquots maintain activity when stored at 4°C for up to one week as recommended .

Batch Consistency Documentation:

  • Certificate of Analysis:

    • Create a standardized document for each batch with:

      • Purity assessment results

      • Activity measurements for both enzymatic functions

      • Protein concentration

      • Date of preparation and expiration

      • Lot-specific storage recommendations

  • Reference Standards:

    • Maintain a reference standard from a well-characterized batch to validate new preparations.

    • Periodically verify the stability of this reference standard.

By implementing this comprehensive quality control framework, researchers can ensure that their studies with recombinant Salmonella gallinarum Aas protein yield reproducible and reliable results, facilitating accurate characterization of this important bifunctional enzyme.

How can undergraduate students be effectively trained to work with recombinant Aas protein in research settings?

Introducing undergraduate students to research with recombinant Salmonella gallinarum Aas protein requires a structured approach that builds both technical skills and conceptual understanding. The following training framework is designed to effectively integrate students into research involving this complex bifunctional protein:

Preparatory Knowledge Development:

  • Foundational Literature Review:

    • Guide students through key papers on Aas function, focusing on:

      • The bifunctional nature of the protein (acyltransferase and acyl-ACP synthetase activities)

      • The role of conserved residues like H36 in catalysis

      • Biological significance in phospholipid metabolism

  • Structured Learning Modules:

    • Develop short tutorial sessions on:

      • Membrane protein biochemistry fundamentals

      • Enzyme kinetics principles

      • Bacterial lipid metabolism

      • Laboratory safety when working with recombinant proteins

  • Research Context:

    • Explain how Aas research connects to broader questions in:

      • Bacterial pathogenesis of S. gallinarum in poultry

      • Antimicrobial development strategies

      • Evolutionary conservation of metabolic pathways

Technical Skills Training Sequence:

  • Basic Laboratory Skills (Weeks 1-2):

    • Proper pipetting technique and standard solution preparation

    • Aseptic technique for handling bacterial cultures

    • Protein concentration determination methods

    • SDS-PAGE and Western blotting techniques

  • Intermediate Skills (Weeks 3-4):

    • Small-scale expression of recombinant proteins in E. coli

    • Basic protein purification techniques using His-tag affinity chromatography

    • Proper handling and storage of purified Aas protein

    • Reconstitution of lyophilized protein preparations

  • Advanced Techniques (Weeks 5-8):

    • Simple activity assays for one or both Aas functions

    • Data analysis and enzyme kinetics calculations

    • Troubleshooting approaches for activity loss

    • Experimental design for comparing wild-type and mutant proteins

Structured Research Projects:

  • Beginner Projects:

    • Optimization of storage conditions for maintaining Aas activity

    • Comparison of different expression conditions on protein yield

    • Effect of pH and temperature on enzyme activity

  • Intermediate Projects:

    • Testing substrate specificity of the acyltransferase activity

    • Investigating the effect of detergents on protein stability

    • Developing improved activity assays for either function

  • Advanced Projects:

    • Characterization of simple mutants (e.g., confirming the H36A phenotype)

    • Structure-function analysis using existing mutants

    • Collaborative projects comparing Aas with homologs from other species

Pedagogical Approaches:

  • Scaffolded Protocols:

    • Provide detailed protocols initially, gradually transitioning to outline protocols that require more independent thinking

    • Include troubleshooting decision trees for common issues

  • Peer Learning:

    • Pair new students with more experienced peers

    • Establish journal clubs where students present and discuss recent Aas-related literature

  • Documentation Skills:

    • Train students in proper laboratory notebook keeping

    • Guide students in preparing research summaries and presentations

  • Research Community Integration:

    • Involve students in research group meetings

    • Encourage participation in undergraduate research symposia

    • When appropriate, include students in manuscript preparation

Assessment and Feedback:

  • Technical Competency Assessment:

    • Use practical examinations to evaluate laboratory techniques

    • Have students demonstrate protocols to peers or mentors

  • Conceptual Understanding:

    • Ask students to explain the relationship between Aas structure and function

    • Have students interpret experimental results in the context of existing literature

  • Regular Feedback Sessions:

    • Schedule weekly one-on-one meetings to discuss progress

    • Provide constructive feedback on technique and scientific reasoning

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.