Recombinant Salmonella gallinarum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella gallinarum Cobalamin Synthase (cobS)

Recombinant Salmonella gallinarum Cobalamin synthase (cobS) is a bioengineered protein derived from the cobS gene of S. gallinarum, a poultry-specific pathogen causing fowl typhoid. This enzyme catalyzes the final steps of cobalamin (vitamin B₁₂) biosynthesis, a critical metabolic pathway for bacterial survival under anaerobic conditions . The recombinant form is typically expressed in Escherichia coli with an N-terminal His-tag for purification and structural studies . Below is a detailed analysis of its structure, function, and research applications.

Role in Salmonella gallinarum Pathogenesis

Cobalamin biosynthesis is vital for S. gallinarum survival in anaerobic environments encountered during host infection. Studies on cobS mutants reveal:

Metabolic Dependency

  • S. gallinarum requires cobalamin for energy metabolism and DNA synthesis.

  • Single deletions in cobS or cbiA (another cobalamin biosynthesis gene) did not attenuate virulence, as compensatory pathways may exist .

  • Double mutants (ΔcbiA ΔcobS) were non-virulent, indicating cobalamin biosynthesis is indispensable for systemic infection .

MutationEffect on VirulenceMortality in Chickens
Wild-typeFull virulence80%
ΔcobSNo attenuation80–100%
ΔcbiANo attenuation80–100%
ΔcbiA ΔcobSComplete attenuation0%

Vaccine Potential

The ΔcbiA ΔcobS double mutant shows promise as a live-attenuated vaccine strain. It persistently colonizes host organs (e.g., liver, spleen) at low levels, inducing protective immunity without causing disease .

Biochemical Studies

The recombinant cobS protein is used to:

  • Investigate cobalamin biosynthesis pathways.

  • Elucidate enzyme kinetics and substrate specificity .

  • Develop assays for detecting cobalamin-dependent metabolic activity.

Vaccine Development

  • Attenuated Strains: ΔcobS mutants are being explored as vaccine candidates, though single deletions retain virulence .

  • Recombinant Vaccines: While not directly involving cobS, S. gallinarum strains expressing heterologous antigens (e.g., APEC fimbriae) are being tested for dual protection against fowl typhoid and avian colibacillosis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
cobS; SG2041; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: seg:SG2041

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Salmonella gallinarum Cobalamin synthase (cobS) protein?

Cobalamin synthase (cobS) is an enzyme in Salmonella gallinarum involved in the biosynthesis pathway of vitamin B12 (cobalamin). It is specifically identified as adenosylcobinamide-GDP ribazoletransferase or cobalamin-5'-phosphate synthase in the literature . The full-length protein consists of 247 amino acids and functions in the final stages of cobalamin synthesis. The protein is essential for the bacterium's metabolism, particularly under anaerobic conditions where vitamin B12-dependent reactions become crucial for bacterial survival . The recombinant form typically contains tags (such as His-tag) for purification purposes and experimental detection .

What expression systems are commonly used for recombinant production of Salmonella gallinarum CobS?

The most common expression system for recombinant Salmonella gallinarum CobS protein is Escherichia coli. Based on the available research, E. coli provides an efficient platform for expressing the full-length cobS protein with N-terminal His-tags for purification purposes . This heterologous expression system allows for high yield production of the protein for experimental studies. The methodology typically involves:

  • Cloning the cobS gene into an appropriate expression vector

  • Transformation into competent E. coli cells

  • Induction of protein expression (often using IPTG or similar inducers)

  • Cell harvesting and lysis

  • Protein purification via affinity chromatography using the His-tag

This approach provides researchers with sufficient quantities of purified recombinant protein for functional studies, structural analyses, and antibody production.

How can the cobS gene be effectively deleted for functional studies in Salmonella gallinarum?

Based on available research methodologies, there are several approaches to effectively delete the cobS gene in Salmonella gallinarum for functional studies:

  • Lambda Red Recombineering: This technique has been successfully employed for generating gene deletions in Salmonella. The methodology involves:

    • Using plasmids containing λ-Red recombination elements (such as pKD46)

    • Designing primers with homology arms flanking the cobS gene

    • PCR amplification of antibiotic resistance cassettes

    • Transformation of the PCR product into Salmonella cells expressing λ-Red proteins

    • Selection of recombinants using appropriate antibiotics

    • Verification of gene deletion by PCR and sequencing

  • CRISPR/Cas9-Based Deletion: A more recent approach involves using CRISPR/Cas9 technology:

    • Designing guide RNAs targeting the cobS gene

    • Co-transformation with plasmids expressing Cas9 and the guide RNA

    • Including homology arms to facilitate recombination

    • Screening transformants for successful deletions

For validating gene deletion, researchers typically perform colony PCR using primers that bind to regions flanking the targeted gene. Successful deletions show a PCR product of the expected size difference compared to the wild-type strain .

What is the role of CobS in the virulence of Salmonella gallinarum in avian hosts?

Research on cobS mutants has provided significant insights into the role of cobalamin synthesis in Salmonella gallinarum virulence:

  • Single cobS Mutation Effects: Interestingly, singular deletion of the cobS gene does not significantly attenuate virulence in Salmonella Gallinarum when tested in susceptible chickens. In fact, some studies suggest that diluted SG mutants with single cobS deletion may produce higher mortality than the wild strain of SG .

  • Double Mutation Effects: When double mutation is carried out (such as combined cbiA and cobS deletions), the Salmonella Gallinarum mutant becomes significantly attenuated and unable to cause mortality in susceptible chickens .

  • Mechanistic Explanation: This phenomenon is likely related to vitamin B12's critical role in bacterial metabolism under anaerobic conditions, which Salmonella experiences during intracellular survival within host cells. The complete disruption of the cobalamin biosynthesis pathway (through double mutations) appears necessary to fully attenuate virulence .

  • Host-Specific Considerations: The relative importance of cobS may vary across different host species, with particular significance in avian hosts where Salmonella Gallinarum causes fowl typhoid .

These findings indicate that while cobS alone may not be essential for virulence, the complete cobalamin biosynthesis pathway plays a crucial role in Salmonella Gallinarum pathogenesis in chickens.

What experimental protocols are recommended for assessing CobS protein purity and activity?

For researchers working with recombinant Salmonella gallinarum CobS protein, the following protocols are recommended:

Purity Assessment:

  • SDS-PAGE Analysis: Standard method showing >90% purity is typically achieved using optimized purification protocols

  • Western Blotting: Using anti-His antibodies for tagged proteins

  • Mass Spectrometry: For precise molecular weight confirmation and identification

Activity Assessment:

  • Enzymatic Assays: Monitoring the conversion of adenosylcobinamide-GDP to adenosylcobalamin

  • Spectrophotometric Methods: Following reaction kinetics by spectral changes

  • Coupled Assays: Measuring activity in conjunction with other enzymes in the cobalamin biosynthesis pathway

Storage and Handling Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial

Following these protocols ensures reliable experimental outcomes when working with recombinant CobS protein.

How are cobS mutants of Salmonella gallinarum tested in animal models?

The testing of cobS mutants in animal models, particularly chickens, follows established protocols for assessing virulence and immunogenicity:

Standard Testing Protocol:

  • Animal Selection and Housing:

    • Disease-free broiler chickens (typically Cobb 500 or similar)

    • Commercial hatchery sourcing

    • Birds housed in pre-sterilized cages with controlled environmental conditions

    • Random distribution into experimental groups

  • Pre-Screening and Preparation:

    • Screening for pre-existing Salmonella infection at 7 days of age through cloacal swabs

    • Provision of antibiotic-free feed and water throughout the experiment

    • Baseline weight measurements prior to infection

  • Infection Procedure:

    • Oral inoculation at approximately 16 days of age

    • Standard dose of 0.5 ml containing approximately 1 × 10^8 CFU

    • Multiple experimental groups: wild-type strain, cobS mutant strain, and negative control

  • Monitoring and Assessment:

    • Daily clinical sign monitoring

    • Regular weight measurements (3 times weekly)

    • Mortality recording

    • Postmortem examination of dead or severely ill birds

    • Sample collection from liver, spleen, and other organs for bacterial enumeration

    • Tissue sampling for histopathology and cytokine analysis

  • Extended Immunity Studies:

    • For attenuated strains, persistence studies (25+ days)

    • Challenge with virulent wild-type strain to assess protection

    • Serology to measure antibody responses

This standardized approach allows researchers to accurately assess the impact of cobS mutations on Salmonella Gallinarum pathogenicity and potential vaccine applications.

What are the critical parameters to monitor when using cobS mutants for vaccine development?

When evaluating cobS mutants of Salmonella gallinarum for potential vaccine applications, researchers should focus on the following critical parameters:

Safety Parameters:

  • Attenuation Stability: Ensure genetic stability of the cobS mutation through multiple passages

  • Residual Virulence: Monitor for any clinical signs, mortality, or pathological changes following vaccination

  • Tissue Distribution: Assess bacterial load in organs, particularly liver and spleen

  • Persistence: Determine how long the attenuated strain remains in host tissues (ideally should persist long enough to induce immunity without causing disease)

Efficacy Parameters:

  • Protective Efficacy: Measure protection against wild-type challenge, including:

    • Mortality reduction

    • Clinical sign reduction

    • Bacterial clearance from organs

  • Immune Response Markers:

    • Antibody titers (serum IgG, mucosal IgA)

    • Cell-mediated immunity (T-cell responses)

    • Cytokine profiles (particularly IL-1β, TNF-α, and CXCLi1)

Comparative Analysis:

  • Side-by-Side Comparison: Direct comparison with commercially available vaccines

  • Cross-Protection: Assessment of protection against heterologous Salmonella serovars

  • Duration of Immunity: Long-term studies to determine protection longevity

Research indicates that double mutants involving cobS may be more promising as vaccine candidates than single cobS mutants, as the former show complete attenuation while potentially maintaining immunogenicity .

How does CobS function interact with other virulence factors in Salmonella gallinarum pathogenesis?

Metabolic Interactions:

  • Anaerobic Survival: CobS contributes to vitamin B12 biosynthesis, which is crucial for anaerobic respiration and metabolism within host cells. This metabolic capability interacts with other virulence factors that depend on bacterial survival in low-oxygen environments .

  • Nutritional Immunity: The ability to synthesize vitamin B12 helps Salmonella overcome nutritional limitations imposed by the host, thereby supporting the function of other virulence determinants .

Virulence Factor Interactions:

  • Relationship with SpvB: Research has shown interesting relationships between different virulence genes. For example, while single cobS mutation doesn't significantly reduce virulence, SpvB gene deletion results in attenuation of S. gallinarum in broiler chickens . This suggests potential functional relationships between metabolic and explicit virulence genes.

  • Interface with wecB Pathway: The wecB gene, involved in enterobacterial common antigen biosynthesis, is critical for S. gallinarum virulence. Studies indicate potential metabolic interactions between cobalamin biosynthesis and cell surface component synthesis pathways .

Transcriptional Networks:

  • Coordinated Regulation: Under specific host conditions, the expression of cobS and other virulence factors may be coordinately regulated, suggesting intricate regulatory networks that optimize bacterial fitness during infection.

  • Stress Response Integration: Vitamin B12 metabolism likely interfaces with stress response systems that are activated during host colonization .

What are the optimal conditions for recombinant CobS protein storage and reconstitution?

For researchers working with recombinant Salmonella gallinarum CobS protein, the following storage and reconstitution protocols are recommended based on experimental evidence:

Storage Conditions:

  • Temperature: Store at -20°C/-80°C upon receipt

  • Format: Typically supplied as lyophilized powder

  • Aliquoting: Division into working aliquots is necessary for multiple use

  • Freeze-Thaw: Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Working Storage: For short-term use, store working aliquots at 4°C for up to one week

Reconstitution Protocol:

  • Centrifugation: Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Diluent: Reconstitute in deionized sterile water

  • Concentration: Prepare to a concentration of 0.1-1.0 mg/mL

  • Cryoprotectant: Add glycerol to a final concentration of 5-50% (50% is standard)

  • Buffer System: The protein is typically stable in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Following these protocols ensures optimal protein stability and activity for downstream applications such as enzymatic assays, structural studies, and antibody production.

What analytical techniques are most effective for characterizing CobS protein structure and function?

Several analytical techniques have proven effective for characterizing the structure and function of recombinant Salmonella gallinarum CobS protein:

Structural Characterization:

  • X-ray Crystallography:

    • Provides high-resolution three-dimensional structure

    • Requires protein crystals of sufficient quality

    • Can reveal active site architecture and substrate binding pockets

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Useful for analyzing protein dynamics in solution

    • Especially valuable for identifying flexible regions and substrate interactions

    • Limited by protein size constraints

  • Circular Dichroism (CD) Spectroscopy:

    • Rapid assessment of secondary structure content

    • Useful for monitoring structural stability under different conditions

    • Less detailed than X-ray or NMR but more accessible

  • Mass Spectrometry:

    • Precise molecular weight determination

    • Peptide mapping for sequence confirmation

    • Identification of post-translational modifications

Functional Characterization:

  • Enzyme Kinetics:

    • Determination of Km, Vmax, and catalytic efficiency

    • Substrate specificity analysis

    • Inhibition studies

  • Isothermal Titration Calorimetry (ITC):

    • Direct measurement of binding thermodynamics

    • Quantification of binding affinity and stoichiometry

    • Analysis of substrate and cofactor interactions

  • Surface Plasmon Resonance (SPR):

    • Real-time binding analysis

    • Association and dissociation kinetics

    • Protein-protein interaction studies

  • Differential Scanning Fluorimetry (DSF):

    • Thermal stability assessment

    • Ligand binding effects on protein stability

    • High-throughput screening capabilities

When combined, these techniques provide comprehensive insights into CobS structure-function relationships, guiding rational approaches to inhibitor design and functional modulation.

How can CobS mutants be utilized for the development of live attenuated vaccines?

The development of live attenuated vaccines using CobS mutants follows several key principles and methodological approaches:

Mutant Development Strategy:

  • Gene Target Selection: Research indicates that single cobS deletion may not provide sufficient attenuation, while double mutations (e.g., cbiA/cobS) show complete attenuation without mortality in susceptible chickens .

  • Genetic Stability: Ensuring stable inheritance of the mutation through multiple generations using precise genetic engineering techniques like λ-Red recombination or CRISPR/Cas9 .

  • Marker Integration: Incorporation of antibiotic resistance markers for initial selection, followed by marker removal using FLP recombinase systems (e.g., pCP20) to create clean deletions .

Vaccine Candidate Assessment:

  • In Vitro Characterization:

    • Growth kinetics in standard media

    • Resistance to environmental stressors (bile, pH, etc.)

    • Genetic stability verification

  • In Vivo Safety Evaluation:

    • Colonization patterns in target organs

    • Persistence duration (ideally 2-3 weeks for immune stimulation)

    • Absence of clinical signs and pathological changes

    • No reversion to virulence

  • Immunogenicity Assessment:

    • Antibody response measurement

    • Cell-mediated immunity evaluation

    • Cytokine profile analysis

  • Protection Studies:

    • Challenge with virulent wild-type strain

    • Monitoring for clinical protection

    • Bacterial clearance measurement

    • Cross-protection against heterologous strains

The research indicates that cobS mutants, particularly when combined with other mutations in vitamin B12 biosynthesis pathway, show promise as vaccine candidates due to their ability to persist at low levels in host tissues while remaining avirulent .

What are the current research gaps in understanding CobS function in Salmonella gallinarum?

Despite significant advances, several important research gaps exist in our understanding of CobS function in Salmonella gallinarum:

Molecular Mechanisms:

  • Structure-Function Relationships: Limited structural data on S. gallinarum CobS impedes understanding of its catalytic mechanism and substrate specificity.

  • Regulatory Networks: Incomplete characterization of how cobS expression is regulated during different stages of infection and in response to various environmental stimuli.

  • Protein-Protein Interactions: Limited knowledge of how CobS interacts with other proteins in the cobalamin biosynthesis pathway and broader metabolic networks .

Host-Pathogen Interactions:

  • Host-Specific Adaptation: Unknown factors explaining why vitamin B12 biosynthesis appears particularly important in avian hosts but less critical in mammalian models.

  • Immune Response Modulation: Limited understanding of how CobS or vitamin B12 metabolism might influence host immune responses beyond survival advantages .

  • Tissue-Specific Requirements: Incomplete data on whether CobS function is equally important across different host tissues during infection.

Translational Research Gaps:

  • Vaccine Development: Need for optimized mutation strategies combining cobS deletion with other targets for ideal balance of attenuation and immunogenicity.

  • Diagnostic Applications: Unexplored potential of anti-CobS antibodies or CobS-based assays for diagnostic purposes.

  • Therapeutic Targeting: Limited exploration of CobS as a potential target for novel antimicrobial strategies .

Addressing these research gaps would significantly advance our understanding of Salmonella gallinarum pathogenesis and potentially lead to improved control strategies for fowl typhoid.

How do findings from Salmonella gallinarum CobS research translate to other bacterial pathogens?

Research on Salmonella gallinarum CobS has broader implications that extend to other bacterial pathogens:

Cross-Species Relevance:

  • Other Salmonella Serovars: Findings from S. gallinarum cobS studies provide insights into cobalamin metabolism across Salmonella species, including human pathogens like S. Typhi, which causes typhoid fever. The mechanisms of virulence attenuation observed in cobS mutants may inform vaccine development strategies for these related pathogens .

  • Broader Enterobacteriaceae: Many enteric pathogens utilize similar cobalamin-dependent metabolic pathways, suggesting that cobS research in S. gallinarum could inform studies on E. coli, Shigella, and other related bacteria .

Metabolic Pathway Conservation:

  • Vitamin B12 Biosynthesis: The cobalamin biosynthesis pathway is conserved across many bacterial species, making findings on cobS function potentially applicable to numerous prokaryotic systems.

  • Anaerobic Metabolism: Insights into how vitamin B12-dependent pathways contribute to anaerobic survival and virulence may translate to other facultative anaerobic pathogens .

Translational Applications:

  • Vaccine Development Principles: The finding that double mutations in the cobalamin pathway produce attenuated strains suggests a general strategy for live attenuated vaccine development across multiple bacterial species .

  • Metabolic Targeting: Understanding the critical role of vitamin B12 metabolism in pathogenesis could inform novel antimicrobial strategies targeting these pathways in multiple pathogens.

  • Host-Specificity Mechanisms: Research on how cobS contributes to S. gallinarum's host specificity might provide insights into host adaptation mechanisms in other host-restricted pathogens .

This translational potential underscores the value of fundamental research on specific components like CobS, as findings often have broad implications across microbiology and infectious disease research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.