Recombinant Salmonella gallinarum Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli systems, followed by affinity chromatography using the His tag . Critical production metrics include:

ParameterSpecification
Purity≥90% (SDS-PAGE) or ≥85% (alternative protocols)
FormulationLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Research Applications

Recombinant RnfE is utilized in diverse experimental contexts:

  • Immunological Studies: Serve as an antigen for antibody production in ELISA and Western blotting .

  • Metabolic Research: Investigate electron transport mechanisms in Salmonella and related pathogens .

  • Vaccine Development: Used in constructing attenuated Salmonella strains for poultry vaccines (e.g., SG100-series mutants) .

Functional Insights from Studies

  • Role in Pathogenicity: While RnfE itself is not a virulence factor, Salmonella gallinarum strains lacking critical metabolic genes (e.g., purB) show attenuated virulence, highlighting the importance of auxiliary proteins in systemic infections .

  • Electron Transport Efficiency: The Rnf complex, including RnfE, is essential for maintaining redox balance under anaerobic conditions, a trait exploited in bacterial survival studies .

Comparative Analysis with Orthologs

Recombinant RnfE homologs from other species (Vibrio cholerae, Haemophilus influenzae) share 60–75% sequence identity but differ in host-specific adaptations .

SpeciesIdentity (%)Key Functional Divergence
S. gallinarum100Baseline for avian-specific studies
Vibrio cholerae68Enhanced salt tolerance in electron transport
Haemophilus influenzae72Adaptation to respiratory tract environments

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsxE; rnfE; SG1664; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links

KEGG: seg:SG1664

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Electron transport complex protein RnfE in Salmonella gallinarum?

RnfE is a subunit of the membrane-bound ion-translocating Rnf complex found in Salmonella gallinarum. It functions as part of a larger energy-coupled transhydrogenase system that energetically links cellular pools of ferredoxin and NAD+. The protein is also known as Ion-translocating oxidoreductase complex subunit E or Rsx electron transport complex subunit E (synonyms: rsxE, SG1664) . The full-length protein consists of 230 amino acids and plays a crucial role in electron transport mechanisms within the bacterial cell.

What is the physiological role of the Rnf complex in bacterial metabolism?

The Rnf complex serves as an essential energy conversion system in many anaerobic bacteria. Its primary function is to couple electron transfer between ferredoxin and NAD+ with ion translocation across the membrane. When ferredoxin is more reduced than NADH, the complex catalyzes exergonic electron flow from ferredoxin to NAD+, generating a chemiosmotic potential essential for energy conservation during autotrophic growth. Conversely, when NADH is more abundant than reduced ferredoxin, the Rnf complex operates in reverse, providing reduced ferredoxin necessary for biosynthesis and CO2 reduction. This bidirectional functionality makes the complex crucial for bacterial adaptation to various energy substrates .

What are the optimal conditions for reconstituting lyophilized recombinant RnfE protein?

For optimal reconstitution of lyophilized recombinant RnfE protein, follow these methodological steps:

  • Centrifuge the vial briefly to bring contents to the bottom before opening

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C/-80°C

Reconstituted protein should be handled in Tris/PBS-based buffer at pH 8.0 with 6% Trehalose to maintain stability. Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided.

How can researchers verify the functionality of recombinant RnfE protein in experimental systems?

To assess the functionality of recombinant RnfE protein, researchers should implement a multi-step verification process:

  • Structural integrity assessment: Perform SDS-PAGE analysis to confirm protein purity (>90%) and expected molecular weight

  • Membrane incorporation assay: Evaluate proper insertion into artificial membrane systems using fluorescent probes

  • Electron transfer activity measurement: Establish an in vitro system measuring electron transfer between ferredoxin and NAD+ using spectrophotometric methods

  • Ion translocation assay: Monitor ion (Na+ or H+) movement across membranes using ion-specific fluorescent indicators or electrode-based measurements

The Rnf complex catalyzes electron transfer from reduced ferredoxin (E₀' = -500 to -450 mV) to NAD+ (E₀' = -320 mV), which should be detectable in a properly functioning system. When assessing electron transfer activity, researchers should account for the ion specificity of the complex, as some Rnf complexes use Na+ as a coupling ion while others use protons.

How can RnfE be utilized in developing attenuated Salmonella vaccines?

The RnfE protein can be leveraged in attenuated Salmonella vaccine development through several research approaches:

  • Metabolic attenuation: Targeted modification of the rnfE gene can create metabolically attenuated strains with reduced virulence but maintained immunogenicity

  • Antigen delivery platform: Engineered S. gallinarum with modified RnfE can serve as a vector for heterologous antigen expression, similar to how heat-labile enterotoxin B subunit protein (LTB) has been incorporated in other Salmonella vaccine candidates

  • Immunomodulation: Modifications to the Rnf complex can alter bacterial metabolism, potentially enhancing immune responses through changed pathogen-associated molecular patterns (PAMPs)

Research has shown that attenuated Salmonella Gallinarum vaccines can induce both humoral and cellular immune responses. For example, one study demonstrated that an attenuated SG vaccine secreting LTB induced significant increases in systemic IgG and mucosal secretory IgA levels, as well as enhanced lymphocyte proliferation and increased numbers of CD3+CD4+ and CD3+CD8+ T cells. This resulted in significant protection against fowl typhoid challenge, with only 16% mortality in the immunized group compared to 76% in controls .

What are the challenges in studying RnfE's role within the complete Rnf complex?

Investigating RnfE's specific contributions within the complete Rnf complex presents several methodological challenges:

  • Membrane protein complexity: As a membrane-integral protein, RnfE is difficult to express, purify, and maintain in its native conformation

  • Multi-subunit interactions: The Rnf complex consists of six subunits (in its simplest form), making it challenging to delineate the specific function of RnfE without disrupting the entire complex

  • Redox sensitivity: Working with electron transport proteins requires oxygen-free conditions to maintain native activity

  • Functional redundancy: Potential compensatory mechanisms in bacteria may mask phenotypic effects when only RnfE is modified

To address these challenges, researchers should consider complementary approaches:

How should experiments be designed to study RnfE function in different bacterial growth conditions?

When designing experiments to investigate RnfE function across varying growth conditions, researchers should implement a systematic approach:

Growth ParameterControl ConditionExperimental VariationsKey Measurements
Carbon sourceGlucoseAcetate, H₂/CO₂, MethanolGrowth rate, RnfE expression, Membrane potential
Redox stateStandard redox potentialOxidative/reductive stressNADH/NAD⁺ ratio, Ferredoxin redox state
Ion availabilityStandard Na⁺/H⁺ levelsNa⁺ limitation, H⁺ gradient disruptionIon flux, ATP synthesis, Growth yield
Oxygen tensionAnaerobicMicroaerobic, Aerobic shockOxidative damage markers, Rnf complex integrity

For rigorous experimental design:

  • Include both wild-type and rnfE knockout strains

  • Monitor gene expression using RT-qPCR targeting rnfE and other complex components

  • Perform metabolomic analysis to track changes in central carbon metabolism

  • Measure membrane potential using fluorescent probes such as DiSC3(5)

  • Implement time-course sampling to capture dynamic responses

Statistical analysis should include multiple biological replicates (n≥3) and appropriate controls for each condition tested.

What considerations should be made when analyzing contradictory data regarding RnfE function?

When confronted with contradictory data regarding RnfE function, researchers should employ a systematic troubleshooting and reconciliation approach:

  • Identify potential sources of variability:

    • Differences in protein preparation (tags, expression systems, purification methods)

    • Variations in experimental conditions (pH, temperature, buffer composition)

    • Strain-specific differences in S. gallinarum isolates

    • Assay-specific limitations or artifacts

  • Reconciliation strategies:

    • Perform side-by-side comparisons using standardized protocols

    • Utilize multiple complementary techniques to measure the same parameter

    • Consider context-dependent function (e.g., different roles under different metabolic states)

    • Evaluate the entire Rnf complex rather than isolated RnfE

  • Common contradictions and resolution approaches:

ContradictionPossible ExplanationResolution Strategy
Differing ion specificityStrain-specific variationsCompare sequences and perform site-directed mutagenesis
Inconsistent activity measurementsAssay condition differencesStandardize redox potential and substrate concentrations
Varying phenotypes in knockout studiesGenetic compensationUse conditional/inducible knockouts or rapid depletion systems
Conflicting localization dataSample preparation artifactsUse multiple localization techniques (fractionation, microscopy, protease accessibility)

What are common pitfalls in purification of recombinant RnfE protein and how can they be addressed?

Researchers frequently encounter several challenges when purifying recombinant RnfE protein. Here are the common issues and methodological solutions:

  • Low expression yields:

    • Optimize codon usage for E. coli expression

    • Test different E. coli strains (BL21(DE3), C41(DE3), Rosetta)

    • Reduce expression temperature (16-20°C)

    • Use auto-induction media instead of IPTG induction

  • Protein insolubility:

    • Include appropriate detergents (DDM, LDAO) during cell lysis and purification

    • Add stabilizing agents (glycerol, specific lipids) to buffers

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Implement on-column refolding protocols if necessary

  • Loss of activity during purification:

    • Maintain anaerobic conditions throughout purification

    • Include reducing agents (DTT, β-mercaptoethanol) in all buffers

    • Minimize time between cell disruption and final storage

    • Consider purification at 4°C to reduce proteolytic degradation

A systematic approach to optimization should test these variables sequentially with appropriate controls at each step.

How can researchers overcome challenges in studying electron transport function of RnfE in vitro?

Studying the electron transport function of RnfE in vitro presents unique challenges that require specialized methodological approaches:

  • Maintaining physiological redox conditions:

    • Conduct experiments in anaerobic chambers

    • Use oxygen-scavenging enzyme systems (glucose oxidase/catalase)

    • Pre-reduce all reagents and buffers before use

    • Monitor oxygen levels with sensitive probes

  • Reconstituting functional complexes:

    • Use liposome reconstitution with bacterial lipid extracts

    • Co-express multiple Rnf complex subunits simultaneously

    • Implement nanodisc technology for stable membrane protein incorporation

    • Verify complex assembly using native PAGE or size exclusion chromatography

  • Measuring electron transfer activities:

    • Employ specialized spectrophotometric assays for NAD⁺/NADH conversion

    • Use artificial electron donors/acceptors with defined potentials

    • Implement cyclic voltammetry for direct electrochemical measurements

    • Consider stopped-flow techniques for capturing rapid electron transfer events

The potential difference from reduced ferredoxin (E₀' = -500 to -450 mV) to NAD⁺ (E₀' = -320 mV) allows for the translocation of approximately one ion per electron transferred. This stoichiometry can be used to verify proper complex function in reconstituted systems.

What are promising research avenues for exploring RnfE's role in bacterial pathogenesis?

Several high-potential research directions exist for investigating RnfE's role in bacterial pathogenesis:

  • Host-pathogen energy dynamics:

    • Investigate how RnfE-mediated energy conservation affects S. gallinarum survival in host cells

    • Examine metabolic adaptations during different infection stages

    • Study competitive fitness of wild-type versus rnfE mutants during co-infection models

  • Vaccine development strategies:

    • Explore RnfE as a potential vaccine antigen

    • Develop attenuated strains with modified RnfE function

    • Investigate cross-protection potential against related Salmonella serovars

  • Antimicrobial targeting:

    • Screen for small molecule inhibitors of RnfE function

    • Evaluate synergy between RnfE inhibition and existing antibiotics

    • Assess fitness costs of RnfE inhibition in different host environments

Research on attenuated Salmonella Gallinarum strains has shown promising results for vaccine development. For example, one study demonstrated that an attenuated strain provided efficient protection with only 16% mortality in the immunized group compared to 76% mortality in the control group upon challenge with virulent SG. This indicates the potential for developing effective vaccines targeting or utilizing components of the electron transport system .

How might structural biology approaches advance our understanding of RnfE function?

Advanced structural biology approaches offer significant potential to elucidate RnfE function at the molecular level:

  • High-resolution structure determination:

    • Cryo-electron microscopy of the entire Rnf complex

    • X-ray crystallography of individual domains or stabilized full-length protein

    • NMR spectroscopy of soluble domains to capture dynamic interactions

  • Functional mapping approaches:

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Site-directed spin labeling coupled with EPR spectroscopy to measure distances

    • Cross-linking mass spectrometry to map protein-protein interaction interfaces

    • Molecular dynamics simulations to predict conformational changes during catalysis

  • Structure-guided functional studies:

    • Structure-based mutagenesis of predicted functional residues

    • Computational docking of substrates and potential inhibitors

    • Design of conformation-specific antibodies as research tools

    • Engineering of RnfE variants with altered ion selectivity or substrate specificity

Understanding the structural basis of RnfE function would significantly advance our ability to manipulate this protein for both basic research and applied biotechnology, including vaccine development and antimicrobial targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.