Recombinant Salmonella gallinarum Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdC; SG4184; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALFW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized in anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links

KEGG: seg:SG4184

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is fumarate reductase and what role does the frdC subunit play in Salmonella gallinarum?

Fumarate reductase is an essential enzyme for anaerobic respiration in bacteria, catalyzing the reduction of fumarate to succinate. This process allows Salmonella to generate energy in oxygen-limited environments, which is particularly important during host infection. The enzyme consists of four subunits (frdA, frdB, frdC, and frdD) encoded by the frdABCD operon.

The frdC subunit is a 15 kDa hydrophobic protein that functions as part of the membrane anchor for the complex . It contains transmembrane domains that integrate into the bacterial membrane, allowing the catalytic subunits to function properly. In Salmonella gallinarum, fumarate reductase enables survival in oxygen-limited environments encountered during infection, contributing significantly to virulence and pathogenesis .

How is recombinant Salmonella gallinarum frdC protein typically produced for research purposes?

The standard methodology for producing recombinant frdC protein involves:

  • Gene Cloning: The frdC gene is amplified from Salmonella gallinarum genomic DNA and inserted into an expression vector.

  • Host Selection: E. coli is the most commonly used expression host due to its efficiency and scalability .

  • Vector Design: Expression vectors typically include:

    • An inducible promoter system

    • A purification tag (commonly His-tag) fused to the N-terminus

    • Appropriate selection markers for transformant identification

  • Expression Conditions:

    • Induction at mid-log phase (OD600 ~0.6-0.8)

    • Temperature optimization (typically 25-37°C)

    • Duration of expression (4-24 hours)

  • Purification Process:

    • Cell lysis (sonication or mechanical disruption)

    • Membrane fraction isolation

    • Solubilization with detergents

    • Affinity chromatography using the His-tag

    • Concentration and buffer exchange

The final product is often lyophilized with preservatives like trehalose (6%) and stored at -20°C to -80°C to maintain stability . Researchers typically reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

How does fumarate reductase contribute to Salmonella gallinarum virulence?

Fumarate reductase significantly enhances Salmonella gallinarum virulence through multiple mechanisms:

  • Anaerobic Energy Generation: Enables bacterial survival in oxygen-limited environments within host tissues by catalyzing the final step in anaerobic respiration with fumarate as terminal electron acceptor .

  • Enhanced Tissue Colonization: Supports the metabolic needs of Salmonella during colonization, aiding its proliferation and persistence in the host.

  • Immune Evasion: Helps bacteria persist within immune cells, such as macrophages, where oxygen is limited.

  • Systemic Spread: Facilitates survival in multiple organs during the systemic phase of fowl typhoid infection.

Research has demonstrated that mutations in anaerobic respiration genes, including those affecting fumarate reductase (frdA), result in attenuated virulence in chicken models. In particular, studies showed that mutations in the frdA gene contributed to reduced mortality rates in chickens challenged with mutant strains compared to wild-type S. gallinarum .

What expression systems are commonly used for producing recombinant frdC protein?

Several expression systems are utilized for recombinant frdC production, each with specific advantages:

Expression SystemFeaturesApplications
E. coli BL21(DE3)T7 promoter-based expression; high yieldStandard protein production for biochemical studies
E. coli C41/C43Engineered for membrane protein expressionEnhanced production of properly folded frdC
P FRD Promoter SystemsUses native fumarate reductase promoterExpression under physiologically relevant conditions
Chromosome-Plasmid-BalancedStable expression without selection pressureVaccine development applications
Alternative HostsYeast, baculovirus, or mammalian cellsSpecial applications requiring eukaryotic modifications

The selection criteria should include:

  • Required protein yield

  • Downstream application needs

  • Purification strategy

  • Folding requirements

Most commercial sources utilize E. coli expression systems with His-tags for simplified purification and standardized protocols .

How can researchers optimize expression conditions for producing high-yield, properly folded recombinant Salmonella gallinarum frdC protein?

Optimizing expression of membrane proteins like frdC requires specific strategies to address challenges related to their hydrophobic nature:

Strain Selection and Vector Design:

  • Use specialized E. coli strains (C41/C43) engineered for membrane protein expression

  • Incorporate fusion partners that enhance solubility (SUMO, MBP) alongside purification tags

  • Consider codon optimization for the expression host

Expression Conditions Optimization Matrix:

ParameterRange to TestEffect on Expression
Temperature16-30°CLower temperatures reduce inclusion body formation
Inducer Concentration0.1-1.0 mM IPTGLower concentrations may improve folding
Media CompositionLB, TB, 2YTRich media often improves yield
Growth PhaseOD600 0.4-0.8Early induction may reduce toxicity
Expression Duration4-24 hoursExtended time at lower temperatures may increase yield

Membrane Extraction and Protein Solubilization:

  • Test multiple detergents (DDM, CHAPS, Triton X-100) for optimal solubilization

  • Implement a stepwise solubilization protocol with increasing detergent concentrations

  • Include stabilizing agents like glycerol (5-50%) in buffers as indicated in product specifications

Purification Strategy:

  • Affinity chromatography (IMAC for His-tagged proteins)

  • Size exclusion chromatography to remove aggregates

  • Consider on-column refolding for proteins recovered from inclusion bodies

Quality Control:

  • Circular dichroism to assess secondary structure

  • Thermal shift assays to evaluate stability

  • Functional reconstitution assays to confirm activity

Implementing these methodologies can significantly enhance both yield and quality of recombinant frdC protein for downstream applications.

What are the methodological challenges in studying the functional activity of recombinant frdC in isolation versus as part of the complete fumarate reductase complex?

Studying frdC functionality presents several methodological challenges due to its nature as a membrane-bound component of a multi-subunit complex:

Challenges with Isolated frdC:

  • Lacks intrinsic enzymatic activity when separated from catalytic subunits

  • Requires detergent solubilization, which may affect native conformation

  • Difficult to establish functional assays that directly measure isolated frdC activity

Experimental Approaches:

  • Reconstitution Strategies:

    • Co-expression of all four subunits (frdABCD) followed by complex purification

    • Stepwise reconstitution by combining individually purified subunits

    • Incorporation into proteoliposomes to mimic membrane environment

  • Functional Assessment Methods:

    • Enzyme activity assays measuring fumarate reduction or succinate oxidation

    • Electron transfer measurements using artificial electron donors/acceptors

    • Membrane potential measurements in reconstituted proteoliposomes

  • Protein-Protein Interaction Analysis:

    • Pull-down assays to verify subunit interactions

    • Surface plasmon resonance to measure binding kinetics

    • Cross-linking followed by mass spectrometry to identify interaction sites

The methodological challenge lies in distinguishing between the structural role of frdC (membrane anchoring) and potential effects on the catalytic activity of the complex, requiring carefully designed experiments that isolate specific functions.

How do mutations in the frdC gene affect Salmonella gallinarum virulence in experimental models?

Investigating the impact of frdC mutations on virulence requires systematic experimental approaches:

Mutation Generation Strategies:

  • Targeted Mutagenesis:

    • Site-directed mutagenesis for specific amino acid changes

    • Deletion mutants (complete or partial gene deletion)

    • Insertion mutants (transposon-based or recombineering)

  • Complementation Controls:

    • Wild-type gene reintroduction on plasmids

    • Chromosomal restoration using allelic exchange

    • Expression under native vs. constitutive promoters

Experimental Models for Virulence Assessment:

Model TypeMeasurementsAdvantages
In vitro Cell CultureInvasion rates, intracellular survival, cytokine inductionControlled conditions, mechanistic insights
Chicken InfectionMortality rates, bacterial loads in tissues, clinical signsMost relevant host for S. gallinarum
Organ Culture Ex VivoBacterial replication, tissue damageIntermediate complexity system

Research Findings:
Studies have demonstrated that mutations affecting anaerobic respiration genes, including fumarate reductase, attenuate Salmonella gallinarum virulence in chicken models. The greatest degree of attenuation was observed with mutations affecting nitrate reductase (napA, narG) with additional attenuations induced by a mutation affecting fumarate reductase (frdA) .

What techniques are most effective for analyzing the interaction between frdC and other subunits of the fumarate reductase complex?

Analyzing subunit interactions within the fumarate reductase complex requires a multi-technique approach:

Structural Biology Methods:

  • X-ray crystallography of the entire complex

  • Cryo-electron microscopy for 3D structure determination

  • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

Biochemical Interaction Assays:

  • Co-purification approaches:

    • Tandem affinity purification with tags on different subunits

    • Pull-down assays with immobilized individual subunits

    • Blue native PAGE to analyze intact membrane protein complexes

  • Cross-linking strategies:

    • Chemical cross-linking followed by mass spectrometry

    • Photo-affinity labeling at specific residues

    • Site-specific crosslinkers to map interaction domains

Biophysical Techniques:

  • Förster resonance energy transfer (FRET) between labeled subunits

  • Surface plasmon resonance for binding kinetics determination

  • Isothermal titration calorimetry for thermodynamic parameters

Functional Interaction Analysis:

  • Activity assays with reconstituted complexes containing wild-type or mutated subunits

  • Comparative enzyme kinetics to assess effects of subunit modifications

  • Electron transfer measurements to evaluate coupling efficiency

Research has demonstrated that frdC forms a complex with frdD to create the membrane anchor for the catalytic subunits (frdA and frdB) . In E. coli, it has been shown that excess production of these membrane proteins leads to the formation of intracellular tubular structures, indicating the importance of controlled expression for proper membrane integration and complex assembly .

How does the expression profile of frdC change under different oxygen conditions, and what methodologies best capture these changes?

The expression of frdC is highly regulated by oxygen availability, requiring specialized methods to accurately analyze its dynamic regulation:

Experimental Systems for Oxygen Control:

  • Continuous culture systems:

    • Bioreactors with dissolved oxygen monitoring and control

    • Chemostat cultures with defined oxygen input rates

    • Gradient plates for spatial analysis of oxygen effects

  • Batch culture approaches:

    • Anaerobic chambers with controlled gas composition

    • Sealed vessels with oxygen-scavenging systems

    • Microaerobic conditions using CampyGen or similar systems

Expression Analysis Techniques:

TechniqueApplicationSensitivity
qRT-PCRTargeted mRNA quantificationHigh for specific genes
RNA-SeqGenome-wide transcription analysisMedium-high, comprehensive
Western BlottingProtein level analysisMedium, antibody-dependent
Proteomics (LC-MS/MS)Global protein abundanceHigh, but complex sample preparation
Reporter SystemsReal-time expression monitoringHigh, requires genetic modification

Key Regulatory Mechanisms:
The frdABCD operon is regulated by two cellular regulatory proteins, ArcA and Fnr, which respond to aerobic-anaerobic conditions and cellular growth rate . Under anaerobic conditions, expression levels increase more than 10-fold compared to aerobic conditions .

This regulation ensures that fumarate reductase is primarily expressed when needed for anaerobic respiration, while being repressed during aerobic growth when the reverse reaction (succinate dehydrogenase activity) is performed by a different enzyme complex.

The P FRD promoter of the frdABCD operon has been successfully used to drive expression of other genes under anaerobic conditions, demonstrating its utility as a tool for controlled anaerobic expression .

What are the comparative differences in frdC function between Salmonella gallinarum and other Salmonella serovars, and how might this contribute to host specificity?

Examining frdC across Salmonella serovars provides insights into host adaptation and pathogenesis mechanisms:

Comparative Analysis Approaches:

  • Sequence-based methods:

    • Multiple sequence alignment across serovars

    • Phylogenetic analysis of evolutionary relationships

    • Identification of serovar-specific polymorphisms or modifications

  • Functional genomics:

    • Comparative transcriptomics under identical conditions

    • Promoter activity analysis across serovars

    • Regulatory network mapping for anaerobic genes

Experimental Comparison Methodologies:

  • Cross-complementation studies with frdC from different serovars

  • Chimeric protein construction to identify functional domains

  • Heterologous expression to assess differences in protein stability or membrane integration

Key Findings and Implications:
The amino acid sequence of frdC appears highly conserved across Salmonella serovars , with identical sequences observed in S. gallinarum, S. agona, and S. choleraesuis.

Host-specific adaptation might be related to:

The highly conserved nature of frdC suggests it performs a fundamental function across Salmonella serovars, with host specificity likely driven by other genetic factors or by differences in regulation and metabolic context.

How can structural analysis of frdC inform the development of inhibitors targeting fumarate reductase activity?

Using structural information to develop inhibitors of fumarate reductase involves several methodological approaches:

Structural Elucidation Methods:

  • Protein structure determination:

    • X-ray crystallography of the complete fumarate reductase complex

    • Cryo-EM for high-resolution structural analysis

    • NMR studies for dynamic regions or smaller domains

  • In silico approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to identify flexible regions

    • Computational prediction of binding pockets

Drug Discovery Strategies:

ApproachMethodologyAdvantages
Virtual ScreeningIn silico screening of compound libraries against structural modelsRapid, cost-effective initial screening
Fragment-BasedIdentification of small molecule fragments that bind to target sitesEfficient exploration of chemical space
Structure-Based DesignRational design based on structural knowledge of binding sitesTarget-specific compounds with optimized interactions

Target Site Considerations:

  • Membrane interface targeting:

    • Compounds disrupting frdC-frdD interaction

    • Molecules affecting membrane integration

    • Agents that alter electron transfer from quinol

  • Subunit interface targeting:

    • Inhibitors blocking assembly of the complete complex

    • Compounds affecting conformational changes required for activity

Validation Methodologies:

  • Enzyme inhibition assays with purified complex

  • Bacterial growth inhibition under anaerobic conditions

  • Mutagenesis studies to confirm binding sites

  • Co-crystallization with inhibitors to verify binding mode

The development of fumarate reductase inhibitors offers potential for new antimicrobials with specific activity against pathogens dependent on anaerobic respiration during infection. Since fumarate reductase plays a crucial role in Salmonella gallinarum virulence , such inhibitors could represent a novel therapeutic strategy for fowl typhoid.

What are the experimental considerations when using recombinant frdC as a vaccine antigen?

Developing vaccines based on recombinant frdC requires addressing several experimental considerations:

Antigen Design and Production:

  • Structural modifications:

    • Removal of hydrophobic transmembrane domains for improved solubility

    • Creation of fusion proteins with carrier molecules (e.g., flagellin)

    • Identification and isolation of immunodominant epitopes

  • Expression systems:

    • Selection of appropriate host for high-quality antigen production

    • Purification strategies maintaining conformational epitopes

    • Endotoxin removal for parenteral administration

Formulation and Delivery Considerations:

ApproachAdvantagesChallenges
Subunit VaccineDefined composition, safetyMay require adjuvants, multiple doses
DNA VaccineIn vivo expression, cellular immunityDelivery efficiency, species limitations
Vector VaccineMimics natural infection, strong immunitySafety concerns, pre-existing immunity to vector
Attenuated Live VaccineComprehensive immunity, single doseSafety, stability, cold chain requirements

Immunological Assessment:

  • Antibody titer measurements (ELISA, neutralization assays)

  • T-cell response evaluation (proliferation, cytokine production)

  • Mucosal immunity assessment (secretory IgA levels)

Protection Evaluation:

  • Challenge studies in appropriate animal models

  • Measurement of bacterial loads in tissues

  • Clinical symptom and mortality assessment

  • Histopathological evaluation of lesions

Recent Research Approaches:
A promising strategy involves using attenuated Salmonella gallinarum strains as vector vaccines. Research has demonstrated that recombinant S. gallinarum vectors expressing heterologous antigens can provide protection against multiple pathogens. For example, an attenuated S. gallinarum strain expressing APEC type I fimbriae (strain SG102) demonstrated significant protection against both APEC and S. gallinarum challenges .

This approach leverages the natural tropism of S. gallinarum while reducing its virulence, potentially providing a platform for delivering frdC or other antigens to stimulate robust immune responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.