Recombinant Salmonella gallinarum Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction

Salmonella gallinarum is a bacterium that causes fowl typhoid, a severe systemic disease in poultry . Salmonella employs various mechanisms to infect its host, and understanding these mechanisms is vital for developing effective control strategies . Fumarate reductase is an enzyme that plays a crucial role in anaerobic respiration, allowing bacteria to thrive in environments with limited oxygen . The frdD gene encodes one of the subunits of fumarate reductase . Recombinant Salmonella gallinarum Fumarate reductase subunit D (frdD) refers to the frdD subunit that is produced using recombinant DNA technology, typically in E. coli .

Characteristics and Production

  • Recombinant Production: The frdD gene from Salmonella gallinarum is inserted into a plasmid, which is then introduced into E. coli cells. These cells are cultured to express the frdD protein, which is then purified for research purposes .

  • Purity: Recombinant proteins are produced to a high degree of purity to ensure that experiments are not affected by other proteins or contaminants .

Function of Fumarate Reductase

Fumarate reductase is essential for anaerobic respiration in bacteria, catalyzing the reduction of fumarate to succinate . This process allows Salmonella to generate energy in the absence of oxygen, which is particularly important during infection within the host tissues .

Role in Virulence and Pathogenesis

The frdD subunit, as part of the fumarate reductase complex, contributes to the virulence of Salmonella gallinarum . By enabling anaerobic respiration, fumarate reductase helps the bacteria to:

  • Survive in Host Tissues: During infection, Salmonella encounters oxygen-limited environments within the host. Fumarate reductase allows the bacteria to continue producing energy, enhancing its survival .

  • Colonize the Host: Anaerobic respiration supports the metabolic needs of Salmonella during the colonization process, aiding in its proliferation and persistence in the host .

  • Evade Immune Responses: By surviving in low-oxygen conditions, Salmonella can persist within immune cells, such as macrophages, and evade the host’s immune responses .

Research Applications

Recombinant Salmonella gallinarum frdD is used in various research applications to study Salmonella pathogenesis and develop new control strategies:

  • Vaccine Development: Attenuated Salmonella strains, including those with deletions in virulence-associated genes like frdD, are being explored as live vaccines. These strains can stimulate the host's immune system without causing disease .

  • Immunological Studies: Recombinant frdD can be used to study the immune responses to Salmonella gallinarum, including the production of antibodies and the activation of immune cells .

  • Drug Target Identification: Understanding the role of fumarate reductase in Salmonella virulence can help identify potential drug targets. Inhibitors of fumarate reductase could be developed to impair Salmonella's ability to cause disease .

Bacterial Colonization

Time Post-Infection (DPI)Group A (SG Δ purB) Liver (CFU/g)Group A (SG Δ purB) Spleen (CFU/g)Group B (SG wild-type) Liver (CFU/g)Group B (SG wild-type) Spleen (CFU/g)
33.11 ± 0.233.21 ± 0.195.50 ± 0.175.12 ± 0.21
72.19 ± 0.192.58 ± 0.256.34 ± 0.325.98 ± 0.24
100.98 ± 0.201.34 ± 0.215.76 ± 0.224.89 ± 0.22
140.0 ± 0.00.0 ± 0.04.54 ± 0.213.88 ± 0.21
210.0 ± 0.00.0 ± 0.03.49 ± 0.162.89 ± 0.29

Note: Adapted from reference . The purB deletion mutant shows reduced colonization in both the liver and spleen compared to the wild-type Salmonella gallinarum.

Antibody Response Data

In one study, chickens immunized with a recombinant Salmonella gallinarum strain expressing APEC type I fimbriae showed significant IgG and sIgA responses . The concentrations were:

  • IgG: 221.50 μg/mL

  • sIgA: 1.68 μg/mL

These data indicate that recombinant Salmonella gallinarum can induce strong humoral and mucosal immune responses, which are crucial for protection against Salmonella and other pathogens .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; SG4183; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL
Uniprot No.

Target Background

Function
Fumarate and succinate interconversion is catalyzed by two distinct, membrane-bound, FAD-containing enzymes: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit D (FrdD) anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links

KEGG: seg:SG4183

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.