Recombinant Salmonella gallinarum Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

PlsY catalyzes the transfer of acyl groups from acylphosphate to glycerol 3-phosphate, initiating phosphatidic acid synthesis in bacterial membranes . Key functional insights:

  • Catalytic Role:

    • Converts acyl-acyl carrier protein to acylphosphate via PlsX .

    • Transfers acyl groups to glycerol 3-phosphate, forming lysophosphatidic acid .

  • Inhibition: Noncompetitive inhibition by palmitoyl-CoA .

Enzymatic PropertyValue
EC Number2.3.1.15
Optimal pH8.0 (Tris/PBS buffer)
Critical ResiduesSer-45, Arg-52, Gly-101, His-155

Pathogenesis Studies

  • Virulence Link: PlsY contributes to membrane lipid biosynthesis, a process critical for S. gallinarum survival in hostile host environments (e.g., bile acid resistance) . Strains with disrupted phospholipid pathways show attenuated virulence in poultry .

  • Genomic Context: The plsY gene (SG3103) is conserved in S. gallinarum strains, including Colombian isolates associated with fowl typhoid outbreaks .

Vaccine Development

  • Recombinant PlsY is used to study host-pathogen interactions. For example, S. gallinarum vaccine candidates expressing heterologous antigens (e.g., E. coli fimbriae) rely on intact membrane biosynthesis pathways for efficacy .

Expression and Purification

  • Vector: pET-based systems in E. coli .

  • Yield: 0.1–1.0 mg/mL after reconstitution .

  • Additives: Glycerol (5–50%) enhances stability during storage .

Functional Validation

  • Assays: Activity confirmed via SDS-PAGE and kinetic studies (Km for glycerol 3-phosphate binding) .

  • Mutagenesis: Gly→Ala substitutions in Motif 2 reduce substrate affinity .

Recent Advances

  • Genomic Degradation Analysis: Machine learning models using PlsY homologs predict S. gallinarum invasiveness by assessing genome degradation patterns .

  • CRISPR/Cas9 Applications: Genome-editing tools have targeted virulence plasmids in S. gallinarum, though plsY itself remains chromosomally encoded .

Challenges and Future Directions

  • Thermostability: Lyophilized PlsY requires strict storage protocols to prevent aggregation .

  • Structural Studies: Cryo-EM data are needed to resolve membrane-associated conformational changes during catalysis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; ygiH; SG3103; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor but not acyl-PO(4).
Database Links

KEGG: seg:SG3103

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of plsY in Salmonella gallinarum membrane biosynthesis?

PlsY functions as an integral membrane protein that transfers acyl groups from acylphosphate to glycerol-3-phosphate in the initial steps of phosphatidic acid formation in bacterial membrane phospholipid biosynthesis. In the most widely distributed bacterial pathway, acyl-acyl carrier protein is first converted to acylphosphate by PlsX, and then PlsY catalyzes the transfer of the acyl group to glycerol-3-phosphate. This process is fundamental to membrane formation and bacterial survival . The enzymatic activity of plsY is essential for bacterial viability, making it a particularly attractive research target for developing novel antimicrobials against Salmonella gallinarum infections in poultry.

How does the membrane topology of plsY contribute to its function?

Based on studies of PlsY in other bacterial species like Streptococcus pneumoniae, the enzyme typically exhibits five membrane-spanning segments, with the amino terminus and two short loops located on the external face of the membrane. The three larger cytoplasmic domains each contain highly conserved sequence motifs that are critical for catalytic function . These structural elements enable plsY to properly orient within the membrane to access both the acylphosphate substrate and glycerol-3-phosphate. In Salmonella gallinarum, similar membrane topology would be expected, though species-specific variations may exist that could influence substrate specificity or regulatory interactions.

What are the essential active site residues in plsY and their contributions to catalysis?

Site-directed mutagenesis studies have revealed critical active site residues in the plsY family of bacterial acyltransferases. Motif 1 contains essential serine and arginine residues that likely participate directly in catalysis. Motif 2 demonstrates characteristics of a phosphate-binding loop and corresponds to the glycerol-3-phosphate binding site; mutations of conserved glycines in this motif to alanines result in a Km defect for glycerol-3-phosphate binding. Motif 3 contains a conserved histidine and asparagine important for activity, along with a glutamate that is critical to the structural integrity of plsY . Understanding these key residues provides a foundation for structure-based drug design targeting Salmonella gallinarum plsY.

What are the most effective methods for cloning and expressing recombinant Salmonella gallinarum plsY?

The recombinant expression of Salmonella gallinarum plsY presents challenges due to its multiple membrane-spanning segments. A recommended approach includes:

  • Gene amplification using PCR with high-fidelity polymerase and primers containing appropriate restriction sites

  • Cloning into expression vectors with inducible promoters (e.g., pET series) and fusion tags (such as His6 or MBP) to facilitate purification

  • Expression in E. coli strains optimized for membrane protein production (C41(DE3) or C43(DE3))

  • Induction at lower temperatures (16-20°C) to enhance proper folding

  • Membrane fraction isolation followed by detergent solubilization (commonly with n-dodecyl-β-D-maltoside or CHAPS)

For functional studies, it's critical to verify that the recombinant protein maintains its native conformation and activity through enzymatic assays measuring the transfer of acyl groups to glycerol-3-phosphate.

How can researchers design effective site-directed mutagenesis experiments to study plsY function in Salmonella gallinarum?

When designing site-directed mutagenesis experiments for Salmonella gallinarum plsY, researchers should:

  • First identify conserved residues across bacterial plsY proteins through sequence alignment, focusing on the three conserved motifs identified in previous studies

  • Design mutagenesis primers with appropriate mismatches to create alanine substitutions or more conservative changes based on the chemistry of the target residue

  • Verify mutations by sequencing

  • Express both wild-type and mutant proteins under identical conditions

  • Compare enzyme kinetics using assays that measure:

    • Binding affinity for glycerol-3-phosphate (Km)

    • Catalytic efficiency (kcat/Km)

    • Substrate specificity for different acyl chain lengths

A systematic approach targeting residues in each of the three conserved motifs will provide comprehensive insights into structure-function relationships in Salmonella gallinarum plsY.

What are the most reliable assays for measuring plsY enzymatic activity?

Researchers can employ several complementary approaches to measure plsY enzymatic activity:

  • Radiolabeled substrate assay: Using [14C]-labeled glycerol-3-phosphate or acylphosphate substrates to directly measure product formation

  • Coupled enzymatic assay: Monitoring phosphate release through coupling with additional enzymes that produce a colorimetric or fluorescent output

  • HPLC-based assay: Separating and quantifying reaction products to determine conversion rates

  • Mass spectrometry: Providing precise identification and quantification of reaction products

For kinetic characterization, reactions should be performed with varying substrate concentrations to determine Km and Vmax values. Additionally, testing the enzyme under different pH conditions, temperatures, and in the presence of potential inhibitors can provide valuable insights into optimal assay conditions and inhibitory mechanisms.

How can plsY be targeted for vaccine development against Salmonella gallinarum infections?

Developing vaccines targeting plsY in Salmonella gallinarum requires several strategic approaches:

  • Epitope mapping: Identify immunogenic regions of plsY that are exposed on the bacterial surface through computational prediction and experimental validation

  • Recombinant subunit vaccines: Express and purify the extracellular domains or specific epitopes of plsY for use as antigens

  • Live attenuated vaccines: Generate Salmonella gallinarum strains with modified plsY expression that maintains immunogenicity while reducing virulence

  • DNA vaccines: Design plasmids encoding plsY epitopes for in vivo expression and immune recognition

Similar approaches using other Salmonella antigens have shown promising results. For example, ShdA (an identified in vivo-induced antigen) demonstrated 82% detection rates in clinical serum samples from chickens infected with Salmonella Pullorum . This suggests that properly selected plsY epitopes could similarly serve as effective vaccine components, particularly if they are upregulated during infection.

How does plsY interact with other virulence factors in the pathogenesis of fowl typhoid?

The interaction between plsY and other virulence factors likely involves complex regulatory networks:

  • Membrane integrity and pathogenicity islands: Proper membrane composition facilitated by plsY may be necessary for the function of secretion systems encoded by pathogenicity islands like SPI-14, which plays a crucial role in Salmonella gallinarum virulence

  • Stress response coordination: Under host conditions, plsY may coordinate with stress response systems to modify membrane composition, enhancing resistance to bile salts and host defense mechanisms

  • Immune evasion mechanisms: Alterations in membrane phospholipids may influence surface presentation of antigens, affecting host immune recognition

Experimental approaches to study these interactions include:

What are common challenges when working with recombinant membrane proteins like plsY and how can they be addressed?

Researchers commonly encounter several challenges when working with plsY as a membrane protein:

ChallengeSolution Strategies
Low expression levels- Use specialized expression strains (C41/C43)
- Optimize codon usage for expression host
- Reduce induction temperature
- Test different fusion partners (MBP, GST, SUMO)
Protein misfolding- Express at lower temperatures (16-20°C)
- Include molecular chaperones
- Use mild detergents for solubilization
- Consider cell-free expression systems
Poor solubilization- Screen multiple detergents (DDM, CHAPS, LDAO)
- Test detergent:protein ratios
- Employ lipid nanodiscs or amphipols for stabilization
Activity loss during purification- Include lipids during purification
- Minimize purification steps
- Use affinity chromatography under gentle conditions
- Verify activity at each purification stage

Additionally, expression as fusion proteins with soluble domains can improve folding and stability while providing convenient purification handles. For crystallography or structural studies, consider using thermostabilized variants or antibody fragments to stabilize specific conformations.

How should researchers interpret contradictory results between in vitro and in vivo studies on plsY function?

When facing contradictions between in vitro and in vivo results:

  • Consider environmental differences: In vitro conditions lack the complex host environment, including immune factors, pH variations, and nutrient limitations that may affect plsY function

  • Examine regulatory influences: Expression levels and post-translational modifications of plsY may differ significantly between laboratory media and host environments

  • Assess redundancy: Alternate metabolic pathways may compensate for plsY deficiencies in vivo but not in simpler in vitro systems

  • Evaluate strain differences: Laboratory strains may have accumulated mutations affecting plsY regulation compared to clinical isolates

A systematic approach to resolving contradictions includes:

  • Controlled expression studies comparing plsY levels under various conditions

  • In vitro assays that better mimic in vivo conditions (e.g., including bile salts, varying pH)

  • Using attenuated strains in chicken infection models to directly assess plsY contributions to pathogenesis, similar to studies conducted with SPI-14 mutants

  • Monitoring cytokine responses (IL-1β, IL-12, TNF-α, IFN-γ) to correlate plsY expression with immune activation

What statistical approaches are most appropriate for analyzing plsY enzymatic activity data from mutant studies?

When analyzing enzymatic activity data for plsY and its mutants:

  • For comparing multiple mutants to wild-type:

    • One-way ANOVA followed by Tukey's multiple comparison test allows for comparison across multiple groups while controlling for familywise error rate

    • Non-parametric alternatives (Kruskal-Wallis with Dunn's post-test) should be used for non-normally distributed data

  • For enzyme kinetics data:

    • Non-linear regression for Michaelis-Menten kinetics to determine Km and Vmax parameters

    • Statistical comparison of parameters using extra sum-of-squares F test

    • Confidence intervals for kinetic parameters provide more information than simple point estimates

  • For time-course experiments:

    • Repeated measures ANOVA accounts for the non-independence of measurements

    • Mixed-effects models can handle missing time points and incorporate random effects

  • For in vivo studies:

    • Survival data should be analyzed using Kaplan-Meier curves with log-rank tests, as demonstrated in studies with SPI-14 mutants

    • Bacterial burden data typically requires log-transformation before analysis due to exponential growth patterns

Present results with appropriate visualizations including enzyme kinetic curves, bar graphs with individual data points, and box plots to display data distribution alongside statistical significance.

How might plsY be exploited as a target for novel antimicrobial development against Salmonella gallinarum?

The essential nature of plsY for bacterial membrane biosynthesis positions it as a promising antimicrobial target. Future research should explore:

  • Structure-based drug design: Resolving the crystal structure of Salmonella gallinarum plsY would facilitate computational screening and rational design of specific inhibitors targeting the active site

  • Natural product screening: Testing plant-derived compounds and antimicrobial peptides that may disrupt plsY function through direct binding or membrane interactions

  • Allosteric inhibitors: Developing compounds that bind to regulatory sites rather than the active site may provide greater selectivity

  • Combination approaches: Identifying synergistic effects between plsY inhibitors and existing antibiotics to enhance efficacy and reduce resistance development

The non-competitive inhibition of plsY by palmitoyl-CoA observed in other bacterial species suggests that similar regulatory mechanisms may be exploited in Salmonella gallinarum . Additionally, compounds that specifically target unique structural features of bacterial plsY while sparing host enzymes would be ideal candidates for further development.

What emerging technologies could advance our understanding of plsY function in Salmonella gallinarum?

Several cutting-edge technologies hold promise for deeper insights into plsY function:

  • CRISPR interference (CRISPRi): For tunable repression of plsY expression to study partial loss of function without generating lethal phenotypes

  • Cryo-electron microscopy: To resolve the structure of plsY within its native membrane environment

  • Lipidomics approaches: For comprehensive analysis of membrane composition changes resulting from plsY modulation

  • Single-cell analysis: To examine heterogeneity in plsY expression and activity within bacterial populations during infection

  • Reverse vaccinology: Computational approaches using genomic sequences to identify potential vaccine targets, as demonstrated for other Salmonella antigens

The application of these technologies in controlled experimental systems, coupled with chicken infection models, would provide unprecedented insights into the role of plsY in Salmonella gallinarum pathogenesis and potential interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.