Recombinant Salmonella gallinarum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; SG4028; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links

KEGG: seg:SG4028

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella gallinarum and why is it significant in research?

Salmonella gallinarum is a host-specific bacterial pathogen that causes fowl typhoid, a chronic disease affecting adult chickens. It shares the same antigenic formula (1,9,12:—:—) with Salmonella Pullorum, though the latter causes pullorum disease, an acute diarrheal illness in chicks. Fowl typhoid is typically transmitted through contaminated food or water, making S. gallinarum an important model organism for studying host-pathogen interactions and bacterial adaptation mechanisms. The disease is characterized by clinical signs including weakness, ruffled feathers, huddling, somnolence, greenish-yellow diarrhea, weight loss, and decreased egg production, typically appearing around seven days post-infection . S. gallinarum's host specificity and distinct pathogenesis make it valuable for comparative genomics studies exploring evolutionary events that convert non-pathogenic bacteria into specialized pathogens .

What are mechanosensitive channels and what role does MscL play in bacteria?

Mechanosensitive channels are membrane protein complexes that respond to mechanical forces in the cell membrane, particularly osmotic pressure changes. The large-conductance mechanosensitive channel (MscL) is one of the primary channels that protect bacteria during hypoosmotic shock by releasing cytoplasmic solutes, preventing cell lysis. MscL channels exhibit characteristic conductance and pressure sensitivity properties that can be studied using patch-clamp techniques. These channels form pores in response to membrane tension, allowing the passage of ions and small molecules to maintain cellular integrity during environmental stress . Understanding MscL function is crucial for comprehending bacterial adaptation to changing environments, particularly for pathogens like S. gallinarum that must navigate diverse conditions during infection.

How does the genetic conservation of MscL compare between E. coli and S. gallinarum?

While the search results don't specifically address MscL conservation between these species, we can extrapolate from related research. The MscL protein is highly conserved across bacterial species, suggesting that S. gallinarum likely possesses an MscL homolog with similar structural and functional properties to the well-characterized E. coli MscL. Both organisms belong to the Enterobacteriaceae family, increasing the likelihood of functional conservation. Researchers working with S. gallinarum MscL may initially use E. coli MscL as a reference point for experimental design and interpretation, while remaining attentive to potential species-specific variations that might influence channel properties or regulation pathways. Comparative genomic analyses between these closely related bacterial species can reveal evolutionary patterns in mechanosensitive channel conservation and specialization.

What expression systems are suitable for recombinant S. gallinarum MscL production?

Based on successful approaches with E. coli MscL, recombinant S. gallinarum MscL can likely be expressed using similar systems. The E. coli expression system has proven effective, particularly using a plasmid encoding MscL as a fusion protein with glutathione S-transferase (GST). This approach facilitates purification while maintaining protein functionality. The expression should ideally occur in an E. coli strain with a disruption in the chromosomal mscL gene to prevent interference from native MscL . Alternative expression systems might include cell-free protein synthesis or yeast expression systems for difficult-to-express constructs. Researchers should optimize expression conditions including temperature, induction timing, and media composition to maximize protein yield while ensuring proper folding and membrane insertion of this integral membrane protein.

What purification strategies yield functional MscL protein?

Effective purification of MscL protein can be achieved using affinity chromatography. For GST-tagged MscL, glutathione-coated beads provide a selective capture method. Following capture, thrombin cleavage enables recovery of the MscL protein without the fusion tag, which might interfere with channel function. Throughout purification, it's critical to maintain the protein in appropriate detergent micelles to preserve its native conformation and prevent aggregation . Additional purification steps may include size exclusion chromatography to separate monomeric from oligomeric forms and to remove contaminating proteins. Quality control should include SDS-PAGE analysis to confirm protein purity and Western blotting with anti-MscL antibodies to verify identity. Researchers should carefully monitor protein stability during purification and minimize exposure to extreme temperatures or pH conditions that could compromise structural integrity.

How can researchers confirm the identity and purity of recombinant MscL?

Researchers should employ multiple complementary techniques to confirm MscL identity and purity. Initial verification can include SDS-PAGE analysis to assess protein size and purity, followed by Western blotting using specific anti-MscL antibodies. Mass spectrometry provides definitive identification through peptide mass fingerprinting or sequencing. Circular dichroism spectroscopy can confirm proper secondary structure, particularly important for membrane proteins like MscL. For functional verification, researchers can generate specific anti-MscL polyclonal antibodies, which should abolish channel activity when preincubated with the MscL protein in functional assays . Additionally, N-terminal sequencing can verify correct processing of the fusion protein after thrombin cleavage. Throughout characterization, researchers should maintain appropriate controls including purified E. coli MscL as a reference standard for comparative analysis.

How is the patch-clamp technique applied to study recombinant MscL function?

The patch-clamp technique represents the gold standard for functional characterization of ion channels including MscL. For recombinant MscL studies, the purified protein must first be reconstituted into artificial liposomes. Researchers typically prepare these proteoliposomes using synthetic phospholipids that mimic bacterial membrane composition. The reconstituted channel activity can then be examined using patch-clamp electrophysiology, where glass micropipettes are used to isolate small patches of membrane and record current flowing through individual channels . When studying MscL specifically, researchers apply controlled pressure or suction to the patch pipette to generate membrane tension, thereby activating the mechanosensitive channels. Critical parameters to monitor include single-channel conductance, pressure threshold for activation, channel kinetics (open and closed states), and response to known MscL inhibitors such as gadolinium . This technique provides direct evidence of channel functionality and enables quantitative analysis of mechanosensitive properties.

What liposome reconstitution methods are most effective for MscL functional studies?

Successful reconstitution of MscL into liposomes requires careful attention to lipid composition, protein-to-lipid ratio, and reconstitution conditions. Effective methods typically involve mixing purified MscL protein with preformed liposomes or lipid films, followed by detergent removal through dialysis, gel filtration, or adsorption to bio-beads. The lipid composition should reflect bacterial membrane characteristics, often using mixtures of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin. The protein-to-lipid ratio requires optimization to achieve single-channel recordings; too high a ratio results in multiple channels per liposome, complicating data interpretation . Researchers should verify successful reconstitution through techniques such as dynamic light scattering to assess liposome size distribution, freeze-fracture electron microscopy to visualize protein insertion, and fluorescence-based assays to confirm membrane integrity. Reconstituted proteoliposomes should exhibit characteristic MscL conductance and pressure sensitivity when examined with patch-clamp techniques, confirming that the protein has maintained its native conformation and functionality throughout the purification and reconstitution process.

How can researchers quantify MscL pressure sensitivity and conductance?

Quantification of MscL pressure sensitivity and conductance requires systematic electrophysiological measurements under controlled conditions. Pressure sensitivity is typically assessed by gradually increasing negative pressure (suction) applied to patch pipettes while recording channel opening events. The pressure threshold for activation (P₁/₂) is defined as the pressure at which channels have a 50% probability of opening. This parameter should be determined through multiple independent experiments to establish statistical reliability. Channel conductance is calculated from current-voltage relationships under defined ionic conditions, typically yielding values in the nanosiemens range for MscL . Researchers should standardize experimental conditions including membrane composition, temperature, and ionic strength to enable reliable comparisons between wild-type and mutant channels or between different bacterial species. Data analysis should include statistical treatment of multiple recordings and consideration of potential artifacts from membrane geometry or pipette configuration. The channel's response to gadolinium, a known mechanosensitive ion channel inhibitor, provides an additional functional parameter and control for specificity .

How might the wecB gene influence MscL function in S. gallinarum?

Although direct evidence linking the wecB gene to MscL function in S. gallinarum is not present in the search results, we can formulate a hypothesis based on related findings. The wecB gene in S. gallinarum has been identified as an important virulence factor, playing a critical role in systemic infection in chickens . This gene is involved in the biosynthesis of enterobacterial common antigen (ECA), a surface component that contributes to bacterial resistance against host defenses including bile acids and certain antibiotics. The wecB-mutant strain shows increased sensitivity to bile acids and nalidixic acid , suggesting altered membrane properties. Since MscL function depends critically on membrane composition and properties, alterations in ECA synthesis due to wecB mutation could potentially affect MscL activity through changes in membrane fluidity, thickness, or tension sensing. Researchers investigating this relationship should consider designing experiments that examine MscL function in wild-type versus wecB-mutant S. gallinarum strains, potentially revealing novel connections between surface polysaccharides, membrane properties, and mechanosensitive channel activity in the context of bacterial pathogenesis.

How can immune response data inform MscL research in S. gallinarum infections?

Immune response data from S. gallinarum infection models provide valuable context for MscL research. Studies have shown that S. gallinarum infections trigger significant cytokine responses, with the liver showing particularly strong immune activation compared to the spleen . These organ-specific immune responses may correlate with differential bacterial survival or membrane stress conditions that could influence MscL expression or activity. Researchers investigating MscL in infection contexts should consider examining tissue-specific bacterial gene expression patterns, potentially revealing whether MscL is differentially regulated during infection of various organs. Understanding how host immune factors like bile acids or antimicrobial peptides affect bacterial membrane tension could provide insights into conditions that might activate MscL in vivo. Additionally, researchers might investigate whether MscL activity influences the expression of bacterial virulence factors or stress response elements that modulate host immune recognition, creating a bidirectional relationship between channel function and host-pathogen interactions.

What role might MscL play in S. gallinarum survival under in vivo stress conditions?

MscL likely plays a crucial role in S. gallinarum survival under various stress conditions encountered during infection. When bacteria transition from environmental reservoirs to the host gastrointestinal tract, they experience significant osmotic shifts, pH changes, and exposure to antimicrobial compounds. MscL activation could be particularly important during exposure to bile acids, which are known to stress bacterial membranes. Research has shown that S. gallinarum mutants with defects in membrane components (like the wecB-mutant) show increased sensitivity to bile acids , suggesting that membrane integrity and stress response systems are vital for survival in the host environment. To investigate MscL's specific contributions, researchers could generate MscL-deficient S. gallinarum strains and evaluate their survival under various stress conditions including osmotic shock, bile exposure, and intracellular survival within macrophages. Comparing colonization patterns, persistence, and tissue distribution between wild-type and MscL-mutant strains would provide insights into the channel's importance during different stages of infection. Such studies would bridge molecular biophysics with in vivo pathogenesis research, potentially identifying new strategies for controlling fowl typhoid.

How can researchers address the challenge of membrane protein instability during MscL purification?

Membrane protein instability represents a significant challenge in MscL purification. Researchers can implement several strategies to maintain protein stability throughout the purification process. First, selecting appropriate detergents is crucial—mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often preserve membrane protein structure better than harsh ionic detergents. Throughout purification, maintaining a consistent detergent concentration above its critical micelle concentration prevents protein aggregation. Adding lipids during purification can stabilize the protein by mimicking its native membrane environment. Temperature management is equally important—conducting purification steps at 4°C reduces proteolysis and protein unfolding. Inclusion of protease inhibitors protects against degradation, while glycerol (10-20%) can enhance stability by preventing aggregation. For particularly unstable constructs, researchers might consider nanodiscs or amphipols as alternatives to conventional detergent micelles. Quality control checks should be implemented at each purification stage, using techniques such as size-exclusion chromatography to monitor aggregation state and thermal stability assays to assess protein folding. These approaches have proven successful for related mechanosensitive channels and should be adaptable to S. gallinarum MscL purification .

What controls are essential for validating MscL functional reconstitution experiments?

Rigorous controls are essential for confirming that reconstituted MscL channels maintain their native properties. A critical negative control involves preparing liposomes without protein, which should show no mechanosensitive channel activity when subjected to patch-clamp analysis. Liposomes containing well-characterized E. coli MscL serve as positive controls, providing a reference for expected channel properties . Specific inhibition controls using gadolinium, a known mechanosensitive channel blocker, should abolish channel activity in functional reconstitutions . Additionally, using anti-MscL antibodies to block channel function provides a specificity control—these antibodies should inhibit reconstituted MscL activity when preincubated with the protein . Dose-response relationships for pressure activation should be established to verify proper mechanosensitivity. When introducing mutations or modifications to the MscL protein, wild-type protein reconstituted under identical conditions provides an essential comparative control. For pharmacological studies, vehicle controls must be included to distinguish specific effects from non-specific membrane perturbations. Temperature controls are also important, as channel kinetics can vary significantly with temperature changes. These multifaceted controls collectively ensure that functional observations genuinely reflect MscL properties rather than artifacts of the reconstitution process.

How should researchers analyze and present complex electrophysiological data from MscL experiments?

Analysis and presentation of electrophysiological data from MscL experiments require systematic approaches to extract meaningful physiological information. Raw current traces should be filtered appropriately to remove noise while preserving genuine channel events. Analysis should include quantification of key parameters: single-channel conductance (calculated from current-voltage relationships), open probability as a function of applied pressure (yielding pressure-response curves), and channel kinetics (open and closed dwell times). Statistical analysis should incorporate data from multiple independent experiments, reporting mean values with appropriate measures of variation (standard deviation or standard error). Data visualization should include representative current traces at different pressures, all-points histograms showing conductance states, and pressure-response curves fitted with appropriate mathematical models (typically Boltzmann functions). For mutation studies, researchers should present normalized data allowing direct comparison between wild-type and mutant channels. When analyzing pharmacological interventions, concentration-response relationships should be established, and IC₅₀ values calculated when applicable. Time-series experiments examining channel adaptation or desensitization should include appropriate time controls and statistical analysis of time-dependent changes. Throughout data presentation, researchers should clearly indicate the number of independent experiments and patches recorded, providing transparency about sample sizes and experimental variability .

How might structural studies of S. gallinarum MscL contribute to antimicrobial development?

Structural studies of S. gallinarum MscL could significantly advance antimicrobial development by identifying unique features that could be targeted therapeutically. While MscL is conserved across bacterial species, subtle structural differences might exist in the S. gallinarum version that could be exploited for species-specific targeting. High-resolution structures obtained through techniques such as cryo-electron microscopy or X-ray crystallography would reveal the precise arrangement of transmembrane helices, gating regions, and potential binding pockets. These structures, particularly if captured in different conformational states (closed, intermediate, and open), would provide templates for structure-based drug design. Researchers could use computational approaches to screen virtual compound libraries for molecules that might stabilize MscL in either the closed state (preventing necessary osmoregulation) or the open state (causing cytoplasmic leakage). Since MscL has no known homologs in chickens or humans, compounds targeting this channel would likely have minimal host toxicity. Additionally, understanding how specific mutations affect channel gating could guide the development of compounds that modulate MscL function under particular conditions relevant to infection. Given that S. gallinarum causes significant economic losses in poultry production, MscL-targeted therapeutics could represent a novel approach to controlling fowl typhoid while avoiding traditional antibiotic resistance mechanisms.

What potential exists for developing attenuated S. gallinarum vaccine strains based on MscL modifications?

MscL modifications present intriguing possibilities for developing attenuated vaccine strains against S. gallinarum. By engineering MscL variants with altered gating properties, researchers could potentially create bacterial strains that survive poorly under the osmotic conditions encountered during infection but remain viable enough to stimulate protective immunity. Studies of wecB-mutant S. gallinarum have already demonstrated the principle that attenuated strains can induce protective antibody responses—chickens initially inoculated with wecB-mutant bacteria showed significantly higher survival rates when rechallenged with wild-type S. gallinarum . MscL engineering could provide an alternative attenuation strategy with potentially more predictable outcomes. Researchers could investigate whether MscL gain-of-function mutations (causing inappropriate channel opening) or partial loss-of-function mutations (reducing osmotic stress response capability) produce attenuated strains that maintain immunogenicity. The ideal vaccine strain would replicate enough to stimulate robust humoral and cell-mediated immunity while being cleared more rapidly than wild-type bacteria. Development would require careful characterization of bacterial persistence in chicken tissues, similar to studies showing that wecB-mutant bacteria are eliminated from chickens within 35 days post-infection . By combining MscL modifications with other attenuating mutations, researchers might develop multivalent vaccines offering protection against multiple poultry pathogens. This approach could lead to vaccines that are safer, more effective, and less likely to revert to virulence than traditional attenuated strains.

How should researchers design experiments to compare MscL function across different bacterial strains?

Designing robust comparative experiments for MscL function across bacterial strains requires careful attention to standardization and controls. Researchers should first sequence the mscL genes from each strain to document any amino acid differences that might explain functional variations. Expression systems should be identical across strains, ideally using the same vector, promoter, and host cells to eliminate expression-level artifacts. For purification, identical protocols must be applied to all variants, with quality control checks confirming comparable purity and stability. Reconstitution experiments should use the same lipid composition and protein-to-lipid ratios across all samples, as membrane properties significantly influence channel function. Electrophysiological recordings should be conducted under matched conditions (temperature, buffer composition, applied voltages) with randomized testing order to prevent systematic bias. When possible, blinded analysis should be implemented, with the analyst unaware of which strain is being measured. Including internal standards—such as a well-characterized reference channel measured periodically throughout the experiment—helps control for day-to-day variability. Researchers should perform parallel functional assays in native membranes (e.g., using spheroplasts) to confirm that observed differences in reconstituted systems reflect genuine strain variations rather than artifacts of the reconstitution process. This comprehensive approach ensures that comparative studies yield biologically meaningful insights into how MscL function varies across bacterial strains, potentially correlating with differences in ecological niches or pathogenic potential.

How does MscL research contribute to understanding bacterial adaptation during host infection?

MscL research provides critical insights into bacterial adaptation mechanisms during host infection. As bacteria transition between environments during infection—from external sources to the gastrointestinal tract and potentially to systemic sites—they encounter dramatic changes in osmolarity, requiring rapid adaptation to prevent cellular damage. MscL serves as an emergency release valve during hypoosmotic shock, allowing bacteria to survive these transitions. Studies comparing MscL function in environmental versus host-adapted bacterial populations could reveal how channel properties evolve under selection pressure. The channel's role extends beyond osmotic protection—MscL activation may influence membrane permeability to host antimicrobial compounds, potentially contributing to resistance mechanisms. Research has demonstrated that mutations affecting bacterial membrane components like enterobacterial common antigen (produced by the wecB gene) increase sensitivity to bile acids and certain antibiotics . Similar relationships might exist with MscL, where channel properties influence susceptibility to host antimicrobials. Additionally, MscL activation could affect bacterial gene expression through mechanosensitive signaling pathways, potentially regulating virulence factor production in response to mechanical cues encountered during infection. By linking biophysical channel properties to in vivo bacterial behavior, MscL research bridges fundamental science and pathogenesis studies, potentially revealing new targets for controlling infections like fowl typhoid while advancing basic understanding of bacterial adaptation mechanisms.

What implications does S. gallinarum MscL research have for controlling fowl typhoid in poultry production?

S. gallinarum MscL research has significant implications for controlling fowl typhoid, a disease causing substantial economic losses in poultry production. Understanding MscL function could lead to novel control strategies targeting bacterial survival mechanisms rather than conventional virulence factors, potentially circumventing existing resistance mechanisms. If MscL proves essential for S. gallinarum survival during specific infection stages, channel-targeted antimicrobials could provide selective pressure against the pathogen while sparing beneficial gut microbiota. Research into attenuated strains has already demonstrated that chickens inoculated with attenuated S. gallinarum (the wecB-mutant) develop protective antibodies and show significantly higher survival rates when challenged with virulent strains . Similar approaches targeting MscL could yield effective live attenuated vaccines with predictable attenuation mechanisms. MscL research might also inform diagnostic development—if the channel shows unique properties in S. gallinarum compared to commensal bacteria, detection methods targeting these differences could improve specificity. From a biosecurity perspective, understanding how S. gallinarum survives environmental stresses through MscL-mediated mechanisms could inform more effective disinfection protocols for poultry facilities. By advancing fundamental understanding of bacterial survival mechanisms, MscL research creates multiple pathways toward improved fowl typhoid control, contributing to poultry health, production efficiency, and food security while reducing reliance on conventional antibiotics increasingly challenged by resistance development.

How might interdisciplinary approaches enhance MscL research outcomes?

Interdisciplinary approaches can dramatically enhance MscL research outcomes by integrating perspectives from multiple scientific domains. Combining structural biology, electrophysiology, and computational modeling creates a comprehensive understanding of channel function—structural studies reveal the molecular architecture, electrophysiology captures functional dynamics, and computational approaches predict how structural changes affect function. Integrating microbiology with immunology allows researchers to connect channel properties with host-pathogen interactions, revealing how MscL function influences bacterial survival in immune-active environments. Engineering approaches, including nanopore technologies and biosensors, could repurpose MscL's mechanical sensitivity for biotechnological applications. Veterinary medicine perspectives ensure research maintains relevance to actual disease conditions, while epidemiology provides population-level context for understanding transmission dynamics and intervention effectiveness. Systems biology approaches might reveal how MscL fits within broader stress response networks, identifying synergistic targets for multi-pronged intervention strategies. Collaborative research teams bringing together experts from these disciplines could design more comprehensive experiments addressing multiple questions simultaneously. For example, combining in vitro biophysical characterization with in vivo infection models and computational simulations could reveal how specific channel properties influence bacterial fitness in different host environments. Such integrated approaches accelerate translation from basic science to practical applications, whether developing new antimicrobials, designing improved vaccines, or creating diagnostic tools. By transcending traditional disciplinary boundaries, interdisciplinary MscL research maximizes both scientific impact and practical utility in addressing the challenges of bacterial infections.

What specialized equipment configurations optimize MscL functional characterization?

Optimal MscL functional characterization requires specialized equipment configurations tailored to the unique properties of these mechanosensitive channels. For patch-clamp studies, high-resolution pressure control systems are essential—digital pressure clamps with feedback-controlled piezoelectric or pneumatic actuators provide precise, reproducible pressure application. These systems should include real-time pressure monitoring with high temporal resolution to capture rapid gating events. Low-noise amplifiers with high bandwidth capabilities (ideally ≥10 kHz) maximize detection of brief channel openings, while digitizers with high sampling rates (≥100 kHz) prevent aliasing of fast channel transitions. Temperature control systems maintaining consistent recording conditions (typically 20-25°C) are crucial since channel kinetics are temperature-dependent. For advanced applications, simultaneous fluorescence and electrophysiology setups allow correlation of structural dynamics (through labeled channels) with functional measurements. Microfluidic platforms enabling controlled solution exchange during recordings facilitate pharmacological studies and dynamic modulation of ionic conditions. Automated patch-clamp systems modified for liposome recordings can increase throughput for screening studies, though these require validation against conventional manual patch-clamp results. For reconstitution quality assessment, dynamic light scattering instruments and electron microscopy access provide critical verification of liposome size and homogeneity. Implementing these specialized configurations requires significant investment but yields higher-quality data with greater reproducibility, ultimately accelerating research progress in understanding MscL structure-function relationships and potential applications in S. gallinarum research.

How can advanced imaging techniques complement electrophysiological MscL studies?

Advanced imaging techniques provide powerful complementary approaches to electrophysiological MscL studies, offering structural insights that electrical recordings alone cannot capture. Single-molecule fluorescence resonance energy transfer (smFRET) allows visualization of conformational changes during channel gating when appropriate fluorophore pairs are attached to moving channel domains. This technique can reveal intermediate conformational states and their dynamics, particularly valuable for understanding the complex gating mechanisms of MscL. High-speed atomic force microscopy (HS-AFM) enables direct visualization of channel topography in native-like membrane environments, potentially capturing conformational changes during gating with nanometer spatial resolution. Cryo-electron microscopy, particularly single-particle analysis, can reveal high-resolution structures of MscL in different conformational states, providing templates for structure-based drug design. Super-resolution microscopy techniques like STORM or PALM can track the distribution and clustering of MscL channels in bacterial membranes, revealing potential functional microdomains. For in vivo studies, correlative light and electron microscopy (CLEM) can connect channel localization with ultrastructural features of bacterial cells. These imaging approaches are particularly powerful when integrated with simultaneous functional measurements—for example, combining patch-clamp electrophysiology with fluorescence imaging in the same experimental preparation allows direct correlation between structural dynamics and functional states. Such multi-modal approaches provide unprecedented insights into how molecular movements translate into the functional properties that enable MscL to protect bacteria during osmotic stress, potentially revealing new targets for modulating channel function in pathogenic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.