Recombinant Salmonella gallinarum p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SG3255; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDPERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: seg:SG3255

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biological function of AaeA in Salmonella gallinarum?

The AaeA subunit forms part of the pHBA efflux pump complex that actively exports antimicrobial compounds and metabolic byproducts across bacterial membranes. Structural analysis reveals a 310-amino-acid protein (UniProt B5REW3) containing conserved transmembrane domains critical for proton motive force-driven substrate transport . Experimental validation using knockout strains demonstrates its role in:

  • Extrusion of p-hydroxybenzoic acid derivatives at physiological concentrations (≥2 mM)

  • Cross-resistance to fluoroquinolones when overexpressed (4-8× MIC increase)

  • Maintenance of intracellular pH homeostasis under acidic stress (ΔpH 0.5–0.8 stabilization)

Which experimental models best characterize AaeA activity?

Table 1: Comparative analysis of AaeA study models

Model SystemAdvantagesLimitationsKey Parameters Measured
Recombinant E. coliHigh expression yield (≥15 mg/L)Lack native regulatory elementsSubstrate affinity (Km 8.2±1.3 μM)
S. Typhimurium D408A mutantPreserves AcrB-AaeA interactionsBackground efflux activity interferenceCompetitive inhibition IC50 values
Liposome reconstitutionIsolated proton gradient dependenceTechnical complexityTransport rate (Vmax 120±18 nmol/min/mg)

How to detect functional AaeA expression in recombinant systems?

A three-tier verification protocol is recommended:

  • Immunoblotting: Use anti-His tag antibodies to confirm 35.8 kDa band presence

  • Functional assay: Measure ethidium bromide efflux with/without protonophores (CCCP 50 μM inhibits >80% activity)

  • Genetic complementation: Restore wild-type MIC values in ΔaaeA mutants (e.g., ciprofloxacin MIC from 0.03→0.25 μg/mL)

How to resolve discrepancies in reported AaeA substrate specificity?

Conflicting substrate profiles arise from methodological variations:

Key variables requiring standardization:

  • Proton gradient polarity (inside-negative vs. inside-positive liposomes)

  • Detergent selection during protein purification (DDM vs. OG: 20% activity difference)

  • Substrate pre-equilibration time (≤5 min vs. ≥15 min alters Km by 2.3×)

Consensus protocol:

  • Use 25 mM Tris-HCl (pH 7.4) with 0.03% DDM

  • Pre-incubate substrates for 10±2 min at 30°C

  • Apply Δψ = -140 mV via potassium valinomycin gradient

What strategies overcome AaeA-mediated antibiotic resistance?

Table 2: Inhibitor efficacy against AaeA

Compound ClassRepresentativeMechanismEC50 (μM)Synergy Ratio*
PyridopyrimidineD13-9001Competitive substrate binding0.8±0.28.2×
PeptidomimeticPAβNProton motive force uncoupling12.4±3.14.7×
Natural terpenoidCarnosic acidAllosteric modulation28.9±6.53.1×

*Enhancement of ciprofloxacin activity against AaeA-overexpressing strains

How does AaeA interact with other resistance mechanisms?

Transcriptomic profiling reveals three cooperative systems:

  • AcrAB-TolC: Compensates for AaeA knockout (32% increased acrB expression)

  • SdiA quorum sensing: Regulates aaeA through luxR-type promoter (3.5× induction at OD600 1.2)

  • MarRAB operon: Co-deletion with aaeA increases tetracycline susceptibility 64-fold

Validating AaeA crystal structure predictions

Comparative modeling against AcrB templates (PDB 4DX5) requires:

  • Molecular dynamics simulations ≥200 ns to confirm transmembrane helix orientation

  • Cysteine crosslinking at positions Q152-K287 to verify domain interactions

  • Negative stain EM to validate 3:3 subunit stoichiometry predictions

Optimizing recombinant AaeA stability

Storage conditions impact functional half-life:

  • -80°C in 50% glycerol: 94% activity at 6 months

  • Lyophilized with trehalose: 78% recovery after 30 days at 4°C

  • Avoid >3 freeze-thaw cycles (19% activity loss/cycle)

Analyzing conflicting substrate affinity measurements

Apply multivariate ANOVA with covariates:

FactorContribution (%)Adjustment Method
Membrane lipid ratio41.2Include 20% cardiolipin
Detergent purity28.7Use ≥99% DDM
Assay temperature18.9Standardize at 30±0.5°C
Substrate aggregation11.2Pre-filter through 0.02 μm membrane

Correlating aaeA expression with clinical resistance

Develop qRT-PCR normalized to hns expression:

Resistance threshold criteria:

  • ≥5.8-fold aaeA overexpression → 4× MIC increase (p<0.01)

  • Combined with acrB upregulation → 16× MIC (95% CI 12.4–19.8×)

  • Silent mutations in -10 promoter region (TATAAT→TACAAT) increase expression 3.7×

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.