Recombinant Salmonella gallinarum Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella Gallinarum ArnE Protein

The Recombinant Salmonella Gallinarum Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) is a bacterial protein produced via recombinant expression in Escherichia coli. It is part of a lipid modification system critical for bacterial membrane integrity and pathogenicity. ArnE facilitates the flipping of lipid A precursors, such as L-arabinose-phosphoundecaprenol, across bacterial membranes, enabling the biosynthesis of lipopolysaccharide (LPS), a key virulence factor in Salmonella species .

Role in Lipid A Biosynthesis

ArnE is hypothesized to function as a flippase, translocating lipid A precursors (e.g., 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol) across the inner membrane. This process is essential for:

  1. LPS biogenesis: Lipid A anchors the LPS in the outer membrane and modulates immune recognition .

  2. Antibiotic resistance: Lipid A modifications can alter bacterial permeability and susceptibility to antimicrobials .

Production and Purification

ArnE is produced as a recombinant protein in E. coli using standard expression systems. Key production parameters include:

ParameterDetails
Expression VectorNot explicitly stated (likely plasmid-based)
Purification MethodAffinity chromatography (His-tag)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) for stability
Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)

Challenges and Gaps

  • Functional Studies: No experimental data confirm ArnE’s enzymatic activity or interaction with lipid A precursors.

  • Pathogenic Relevance: Unlike spvB (linked to fowl typhoid) or wecB (critical for systemic infection), ArnE’s direct contribution to Salmonella Gallinarum virulence remains uncharacterized .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have a specific format preference, please indicate it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing that tag.
Synonyms
arnE; SG2331; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
arnE
Target Protein Sequence
MIGVILVLASLLSVGGQLCQKQATRPLTVGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWFGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
This protein functions in the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasmic to the periplasmic side.
Database Links

KEGG: seg:SG2331

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella gallinarum ArnE and what is its function in bacterial systems?

ArnE is a critical membrane protein that functions as a subunit of a flippase complex responsible for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane . This protein belongs to the EamA-like transporter family and plays an essential role in bacterial lipopolysaccharide modification systems, which contribute to antimicrobial resistance mechanisms in gram-negative bacteria. The flippase activity is crucial for modifications that reduce the net negative charge of lipopolysaccharide, thereby decreasing susceptibility to cationic antimicrobial peptides.

How can researchers obtain purified recombinant Salmonella gallinarum ArnE for experimental studies?

Recombinant ArnE can be expressed in E. coli expression systems using the following methodology:

  • Expression vector selection: Use vectors containing a strong promoter (e.g., T7) and appropriate selection markers. Include an N-terminal His-tag for purification.

  • Host strain optimization: Select E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3)).

  • Culture conditions: Grow cells at lower temperatures (16-25°C) after induction to promote proper folding of membrane proteins .

  • Purification protocol:

    • Isolate membranes through differential centrifugation

    • Solubilize using detergents like LMNG or DDM

    • Purify using immobilized metal affinity chromatography

    • Consider size exclusion chromatography for increased purity

  • Storage recommendations: Store lyophilized protein at -20°C/-80°C; avoid repeated freeze-thaw cycles; for working aliquots, store at 4°C for up to one week .

What expression systems and conditions yield optimal production of functional recombinant ArnE protein?

While E. coli is the most common expression system for ArnE, optimizing conditions is critical for obtaining functional protein:

Expression system comparison:

SystemAdvantagesDisadvantagesYieldFunctional Activity
E. coli BL21(DE3)High yield, fast growthPotential inclusion bodies+++Variable
E. coli C41/C43Better for membrane proteinsLower yield++Improved
Cell-free systemsAvoids toxicity issuesExpensive, lower yield+High

Optimization parameters:

  • mRNA accessibility optimization: Modify up to the first nine codons with synonymous substitutions to increase translation initiation efficiency. Tools like TIsigner can help design these modifications .

  • Induction conditions: Use lower IPTG concentrations (0.1-0.5 mM) and reduce temperature to 16-20°C after induction.

  • Additives: Include membrane protein stabilizers such as glycerol (5-10%) in culture media.

  • Co-expression strategies: Consider co-expressing with chaperones or partner proteins that may enhance stability and folding.

  • Fusion partners: N-terminal fusions like MBP or SUMO can improve solubility while maintaining purification via the His-tag .

How can researchers verify the functional activity of purified recombinant ArnE protein?

Functional assessment of ArnE flippase activity requires specialized assays:

  • Reconstitution into proteoliposomes:

    • Prepare liposomes with appropriate phospholipid composition

    • Incorporate purified ArnE protein using detergent removal techniques

    • Verify incorporation by density gradient centrifugation or Western blotting

  • Flippase activity assays:

    • Dithionite quenching assay: Similar to methods used for P4-ATPases, incorporate fluorescently labeled lipid analogs (e.g., NBD-labeled lipids) into proteoliposomes and monitor translocation using dithionite quenching .

    • Mass spectrometry-based approaches: Monitor the translocation of native substrates using LC-MS/MS.

    • Radioactive substrate translocation: Use radiolabeled substrates to track movement across the membrane.

  • Functional complementation: Test whether expression of recombinant ArnE can restore polymyxin resistance in arnE-deficient bacterial strains.

How does ArnE compare structurally and functionally to other bacterial flippases?

ArnE/ArnF represents a distinct class of flippases compared to better-characterized P4-ATPase flippases:

FeatureArnE/ArnF FlippaseP4-ATPase Flippases (e.g., Drs2p)
Energy sourceUnclear (possibly proton gradient)ATP hydrolysis
StructureSmaller, fewer transmembrane domainsLarger, 10 transmembrane domains
Substrate4-amino-4-deoxy-L-arabinose-phosphoundecaprenolPhospholipids (PS, PE, PC)
DirectionalityCytoplasmic to periplasmicExofacial to cytosolic
RegulationUnknownOften regulated by C-terminal autoinhibition and interacting proteins

Unlike eukaryotic P4-ATPases that undergo well-characterized conformational changes driven by ATP hydrolysis , the precise mechanism of ArnE/ArnF-mediated flipping remains to be fully elucidated. The protein lacks the canonical DGET motif found in P4-ATPases, suggesting a distinct mechanism for substrate translocation.

What experimental approaches can be used to investigate the membrane topology and structure-function relationships of ArnE?

Advanced structural and topological studies require specialized techniques:

  • Cysteine scanning mutagenesis:

    • Systematically replace residues with cysteine

    • Label with membrane-permeable and impermeable sulfhydryl reagents

    • Determine accessibility to define membrane topology

  • Truncation and chimeric protein analysis:

    • Generate truncated variants to identify essential domains

    • Create chimeric proteins with related flippases to identify substrate specificity determinants

    • Assess function using complementation assays

  • Cryo-EM analysis:

    • Based on approaches used for other membrane proteins

    • Optimize sample preparation with appropriate detergents or nanodiscs

    • Target resolution of <4Å to identify potential substrate binding sites

  • Molecular dynamics simulations:

    • Build homology models based on related transporters

    • Simulate lipid-protein interactions in membrane environments

    • Identify potential translocation pathways and energy barriers

  • Cross-linking studies:

    • Identify interaction interfaces between ArnE and ArnF

    • Use bifunctional cross-linkers of varying lengths

    • Analyze cross-linked products by mass spectrometry

How can researchers design experiments to address conflicting data regarding ArnE substrate specificity?

To resolve questions about substrate specificity:

  • Competitive substrate assays:

    • Reconstitute ArnE in proteoliposomes

    • Perform transport assays with labeled substrate in presence of unlabeled potential competitors

    • Calculate inhibition constants to determine relative affinities

  • Site-directed mutagenesis of predicted binding sites:

    • Identify conserved residues by sequence alignment

    • Generate point mutations of charged/polar residues in transmembrane domains

    • Assess impact on substrate binding and transport

  • Direct binding studies:

    • Develop fluorescence-based substrate binding assays

    • Use isothermal titration calorimetry to measure binding thermodynamics

    • Employ surface plasmon resonance with immobilized protein to measure binding kinetics

  • In vivo substrate analysis:

    • Generate arnE knockout strains and complement with wild-type or mutant variants

    • Analyze lipopolysaccharide composition by mass spectrometry

    • Correlate changes in LPS composition with protein function

What quasi-experimental approaches can be applied to study ArnE function in complex bacterial systems?

Based on quasi-experimental design principles , researchers can implement:

  • Natural experiment approaches:

    • Compare naturally occurring ArnE variants across bacterial strains

    • Analyze antibiotic resistance patterns in clinical isolates with ArnE mutations

    • Use regression discontinuity designs to establish causality

  • Interrupted time-series analysis:

    • Monitor antibiotic resistance development over time with controlled ArnE expression

    • Apply statistical controls to account for confounding variables

    • Establish temporal relationships between ArnE activity and resistance phenotypes

  • Regression discontinuity designs:

    • Identify threshold effects in ArnE expression levels

    • Compare bacterial populations just above and below critical expression thresholds

    • Control for population heterogeneity using appropriate statistical methods

  • Matched case-control studies:

    • Compare isogenic strains differing only in ArnE expression

    • Match controls based on growth rates and other physiological parameters

    • Implement propensity score matching to reduce confounding

How can researchers develop experimental systems to study ArnE-ArnF complex formation and its impact on flippase activity?

The ArnE-ArnF complex likely functions as a heterodimer or higher-order complex, requiring specialized approaches:

  • Co-purification strategies:

    • Co-express differentially tagged ArnE and ArnF

    • Use tandem affinity purification to isolate intact complexes

    • Analyze stoichiometry by analytical ultracentrifugation

  • FRET-based interaction studies:

    • Generate fluorescently tagged ArnE and ArnF variants

    • Monitor FRET efficiency as measure of interaction

    • Perform competition experiments to identify interaction domains

  • Bimolecular fluorescence complementation (BiFC):

    • Split fluorescent protein between ArnE and ArnF

    • Reconstitute fluorescence upon complex formation

    • Visualize complex formation in bacterial membranes

  • In vitro reconstitution of the complete flippase:

    • Purify individual components and reconstitute in defined ratios

    • Assess activity as function of complex composition

    • Identify minimum components required for activity

  • Crosslinking mass spectrometry:

    • Use chemical crosslinkers to stabilize transient interactions

    • Identify crosslinked peptides by mass spectrometry

    • Generate structural models based on distance constraints

What are the critical parameters for optimizing recombinant ArnE protein yield and stability?

Based on experimental data from similar membrane proteins, researchers should consider:

  • Expression optimization:

    • Evaluate multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Lemo21(DE3))

    • Test induction at different OD600 values (0.4-0.8)

    • Optimize IPTG concentration (0.1-1.0 mM)

    • Compare expression at different temperatures (16°C, 25°C, 30°C)

  • Membrane extraction efficiency:

    • Test different cell disruption methods (sonication, French press, homogenization)

    • Optimize buffer composition (pH, salt concentration, glycerol percentage)

    • Evaluate protective additives (reducing agents, protease inhibitors)

  • Detergent screening:

    • Systematic evaluation of detergent types (DDM, LMNG, DM, OG)

    • Optimize detergent concentration and solubilization time

    • Consider lipid addition during solubilization

  • Storage stability:

    • Compare lyophilization vs. frozen storage

    • Evaluate different buffer compositions for long-term stability

    • Test stabilizing additives (glycerol, trehalose, specific lipids)

Based on search results, storage at -20°C/-80°C with aliquoting to prevent freeze-thaw cycles is recommended. For working aliquots, 4°C storage for up to one week is advised .

How can researchers address common challenges in functional reconstitution of ArnE into proteoliposomes?

Successful reconstitution requires addressing several technical challenges:

  • Optimization of lipid composition:

    • Test various lipid compositions (POPC, POPE, POPG mixtures)

    • Include native bacterial lipids (especially for functional studies)

    • Optimize protein:lipid ratios (typical range: 1:50 to 1:1000 w/w)

  • Detergent removal methods:

    • Compare dialysis, Bio-Beads, and dilution methods

    • Optimize detergent removal rate (slow removal often yields better results)

    • Monitor liposome formation by dynamic light scattering

  • Orientation control:

    • Assess protein orientation by protease protection assays

    • Use asymmetric labeling to distinguish inside-out vs. right-side-out incorporation

    • Optimize reconstitution conditions to achieve desired orientation

  • Functional validation methods:

    • Implement dithionite quenching assays similar to those used for P4-ATPases

    • Pre-quench outer leaflet for increased sensitivity in detecting flippase activity

    • Use appropriate controls (non-functional mutants, Na+-ATP vs. Mg2+-ATP)

  • Troubleshooting strategies:

    • Verify protein integrity after reconstitution by SDS-PAGE

    • Test reconstitution in presence of stabilizing additives

    • Screen different detergents for initial solubilization

How can recombinant ArnE be utilized in development of Salmonella gallinarum vaccine candidates?

ArnE can be integrated into vaccine development strategies:

  • Attenuated live vaccine platforms:

    • Use ArnE as an antigen displayed on attenuated S. gallinarum strains

    • Develop balanced lethal systems for stable expression

    • Evaluate immune responses using serum IgG and mucosal sIgA measurements

  • Recombinant subunit vaccines:

    • Express and purify ArnE for inclusion in subunit vaccine formulations

    • Design constructs exposing immunogenic epitopes

    • Combine with appropriate adjuvants to enhance immunogenicity

  • Multivalent vaccine design:

    • Co-express ArnE with other Salmonella antigens

    • Create fusion proteins linking ArnE epitopes to carrier proteins

    • Evaluate cross-protection against multiple Salmonella serovars

Based on research with recombinant S. gallinarum vaccine candidates, oral immunization can produce robust humoral and mucosal immune responses. For example, recombinant S. gallinarum vaccines expressing APEC type I fimbriae have shown protection rates of 60-65% against lethal challenges .

What experimental approaches can validate the role of ArnE in antimicrobial resistance mechanisms?

To investigate ArnE's role in antimicrobial resistance:

  • Gene knockout and complementation studies:

    • Generate arnE deletion mutants in Salmonella

    • Complement with wild-type or mutant arnE

    • Test susceptibility to polymyxins and other cationic antimicrobial peptides

  • Lipopolysaccharide modification analysis:

    • Use mass spectrometry to analyze LPS modifications

    • Compare wild-type and arnE mutant strains

    • Correlate specific modifications with resistance phenotypes

  • Flippase activity and resistance correlation:

    • Develop quantitative assays for flippase activity

    • Correlate activity levels with MIC values for various antimicrobials

    • Identify threshold activity required for resistance

  • In vivo infection models:

    • Compare virulence of wild-type and arnE mutants in animal models

    • Evaluate efficacy of antimicrobial treatment

    • Assess in vivo selection for compensatory mutations

This research has significant implications for understanding bacterial resistance mechanisms and developing new strategies to combat antimicrobial resistance in animal and human pathogens.

Resources and Further Reading

For researchers seeking additional information on ArnE and related topics, the following resources are recommended:

  • UniProt database entry for Salmonella gallinarum ArnE: B5RCC7

  • Protein Data Bank for structural information on related flippases

  • Bacterial lipopolysaccharide modification pathways databases

  • Experimental methodology resources for membrane protein expression and characterization

  • Vaccine development platforms for poultry pathogens

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.