Recombinant Salmonella gallinarum Probable intracellular septation protein A (yciB)

What is the basic structure and function of Salmonella gallinarum yciB protein?

Salmonella gallinarum Probable intracellular septation protein A (yciB) is a membrane protein consisting of 179 amino acids with a full amino acid sequence of: MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAVFGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLNLAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS . The protein is encoded by the yciB gene and is also identified by the ordered locus name SG1380 in Salmonella gallinarum strain 287/91 / NCTC 13346 .

As suggested by its name, yciB is involved in bacterial cell septation processes during cell division. It functions in coordination with other septation proteins like FtsA, which anchors protofilaments of bacterial tubulin (encoded by ftsZ) to the membrane during the Z ring formation process critical for cell division . The protein likely plays a role in the structural organization of the bacterial cell membrane during division events.

How is recombinant Salmonella gallinarum yciB protein typically produced and stored?

Recombinant Salmonella gallinarum yciB protein is typically produced through standard recombinant protein expression systems. While specific production methods may vary between laboratories, the general approach involves:

• Cloning the yciB gene (SG1380) from Salmonella gallinarum (strain 287/91 / NCTC 13346) into an appropriate expression vector

• Transforming the construct into a suitable bacterial expression host

• Inducing protein expression under optimized conditions

• Purifying the recombinant protein using affinity chromatography, based on the tag incorporated during the cloning process

For storage, the recommended conditions include:

• Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

• Temperature: -20°C for regular storage; -20°C or -80°C for extended storage

• Working aliquots can be stored at 4°C for up to one week

• Repeated freezing and thawing should be avoided to maintain protein integrity

What is the relationship between yciB and bacterial cell division in Salmonella species?

The yciB protein functions within a complex network of proteins involved in bacterial cell division. In Salmonella, cell division involves the formation of a septum at the division site, requiring coordinated action of multiple proteins. While yciB is classified as a "probable" intracellular septation protein, indicating some uncertainty about its precise function, research on related cell division proteins provides context for its likely role.

The cell division process in Salmonella involves:

• Formation of the Z-ring composed of FtsZ proteins (bacterial tubulin homolog)

• Anchoring of FtsZ to the membrane via FtsA protein

• Recruitment of additional septation proteins for proper septum formation

The yciB protein appears to function in this pathway, though the precise mechanism remains under investigation. Research indicates that genes involved in cell division, such as ftsA, are expressed differently depending on the bacterial location within the host, with higher expression levels observed in bacteria harvested from the cecal mucosa compared to those in the intestinal lumen . This suggests that proximity to host tissues may influence cell division rates and, consequently, the expression of septation proteins like yciB.

How does yciB expression vary across different growth conditions and during infection?

The expression of yciB and related cell division proteins in Salmonella species appears to be highly dependent on environmental conditions, particularly during host colonization. Research examining Salmonella enterica Serovar Typhimurium gene expression shows that proteins involved in cell division exhibit differential expression patterns based on their location within the host.

Bacteria harvested from the cecal mucosa demonstrate higher levels of transcription, translation, and cell division compared to those from the intestinal lumen . This is evidenced by increased expression of cell division-related genes like ftsA and mreB near mucosal surfaces. While specific yciB expression data is limited in the provided sources, it likely follows similar patterns given its role in septation.

Several factors affecting expression include:

• Proximity to host tissues

• Nutrient availability (particularly carbon sources)

• Growth phase of the bacterial population

• Host immune responses

Researchers investigating yciB expression should consider these variables when designing experiments, as they may significantly impact results. Techniques such as qRT-PCR, RNA-seq, or reporter gene constructs can be employed to monitor expression levels under different conditions.

What methodologies are most effective for studying yciB function in Salmonella gallinarum?

Several complementary approaches can be used to investigate yciB function:

Genetic Manipulation Techniques:

• Gene knockout/deletion: Creating ΔyciB mutants using λ-Red recombination systems similar to those used for other Salmonella genes

• Complementation studies: Reintroducing the wild-type yciB gene to confirm phenotypic restoration

• Site-directed mutagenesis: Introducing specific mutations to identify critical residues

• Reporter gene fusion: Creating yciB-reporter constructs to monitor expression patterns

Functional Assays:

• Growth curve analysis under different conditions

• Cell morphology examination via electron microscopy

• Membrane integrity assays

• Antibiotic sensitivity testing (particularly against cell wall-targeting antibiotics)

• In vitro and in vivo colonization assays

Protein Interaction Studies:

• Bacterial two-hybrid assays to identify protein-protein interactions

• Co-immunoprecipitation with known septation proteins

• Fluorescence microscopy with tagged proteins to visualize localization during cell division

When studying yciB function, it's important to note that environmental conditions significantly impact septation protein expression. For instance, research on Salmonella enterica showed that bacteria near mucosal surfaces expressed higher levels of cell division proteins compared to those in the intestinal lumen . This suggests that host-relevant conditions should be replicated when possible to obtain physiologically relevant results.

What is the phylogenetic distribution of yciB across Salmonella strains and how conserved is the protein sequence?

Analysis of comprehensive genomic datasets, like the collection of 574 Salmonella Gallinarum isolates spanning from 1920 to 2023 , provides valuable insights into yciB conservation across different strains. While specific yciB phylogenetic data isn't directly presented in the search results, the approach to analyzing genomic variation can be applied to this protein.

Researchers investigating yciB conservation should consider:

• Sequence alignment analysis: Comparing yciB sequences across multiple Salmonella strains to identify conserved domains and variable regions

• Structural prediction: Using bioinformatic tools to predict how sequence variations might affect protein structure and function

• Evolutionary analysis: Constructing phylogenetic trees based on yciB sequences to understand evolutionary relationships

Based on genomic studies of Salmonella Gallinarum, the species appears to be organized into distinct biovars , which may exhibit differences in yciB sequence or expression. Comparative analysis of yciB across these biovars could provide insights into functional adaptations of the protein.

For researchers studying yciB conservation, techniques such as whole genome sequencing followed by comparative genomic analysis would be most effective. The extensive genomic dataset of Salmonella Gallinarum isolates mentioned in the search results could serve as a valuable resource for such analyses.

How can researchers effectively produce and purify recombinant yciB protein for functional studies?

The production and purification of recombinant yciB protein requires careful consideration of its membrane-associated nature. Based on established protocols for similar bacterial proteins, the following methodology is recommended:

Expression System Selection:

• Choose an expression vector with an appropriate tag (His-tag, GST, etc.) that will not interfere with protein function

• Select a bacterial host strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

• Consider using a fusion partner that enhances solubility if initial expression attempts yield insoluble protein

Expression Conditions:

• Induce expression at lower temperatures (16-25°C) to promote proper folding

• Use lower inducer concentrations to prevent overwhelming the membrane insertion machinery

• Optimize growth media composition to support membrane protein production

Purification Strategy:

• Extract membrane proteins using gentle detergents (e.g., n-dodecyl-β-D-maltoside)

• Perform affinity chromatography based on the selected tag

• Consider size exclusion chromatography as a secondary purification step

• Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

Quality Control Assessment:

• SDS-PAGE and Western blotting to confirm protein identity and purity

• Mass spectrometry for precise molecular weight determination

• Circular dichroism to assess secondary structure

For functional studies, it's critical to verify that the purified recombinant protein maintains its native conformation. Researchers should validate protein activity through appropriate functional assays before proceeding with detailed studies.

What are the recommended approaches for generating yciB knockout mutants in Salmonella gallinarum?

Creating yciB knockout mutants requires precise genetic manipulation techniques. Based on successful approaches used for other Salmonella genes, the following methodology is recommended:

λ-Red Recombination System:

• Design PCR primers that amplify an antibiotic resistance cassette flanked by 40-50bp homology regions corresponding to sequences upstream and downstream of yciB

• Transform a plasmid containing λ-Red recombination genes (e.g., pKD46) into the Salmonella gallinarum strain

• Induce expression of the recombination proteins

• Transform the PCR product and select for recombinants on appropriate antibiotic media

• Verify the knockout by PCR and sequencing

• Remove the antibiotic resistance cassette if needed using FLP recombinase (e.g., from plasmid pCP20)

Alternative CRISPR-Cas9 Approach:

• Design sgRNA targeting the yciB gene

• Clone the sgRNA into a CRISPR-Cas9 expression vector

• Design a repair template with homology arms flanking the target site

• Co-transform both constructs and select for edited cells

• Verify the mutation by sequencing

Validation of Mutant Strains:

• Confirm the absence of yciB expression by RT-PCR and Western blotting

• Perform whole genome sequencing to rule out off-target effects

• Complement the mutation by reintroducing yciB on a plasmid to confirm phenotype specificity

• Compare growth curves, morphology, and stress responses between wild-type and mutant strains

Researchers should note that techniques successfully used for generating wecB knockout mutants in Salmonella Gallinarum, as described in search result , provide a practical framework that can be adapted for yciB mutations.

What in vivo models are most appropriate for studying yciB function in host-pathogen interactions?

Based on established research with Salmonella Gallinarum, the following in vivo models are recommended for studying yciB's role in host-pathogen interactions:

Chicken Infection Model:
Salmonella Gallinarum is host-specific to poultry and causes fowl typhoid, making chickens the most physiologically relevant model. Key aspects of this model include:

• Oral Infection Protocol:

  • Use specific-pathogen-free chickens of appropriate age (typically 2-3 weeks old)

  • Administer bacteria suspended in PBS (typically 10^8 CFU per bird)

  • Include sodium bicarbonate pre-treatment to neutralize stomach acid

  • Include appropriate control groups receiving PBS alone

• Assessment Parameters:

  • Clinical scoring (feather condition, depression, activity level)

  • Survival rates and time to death

  • Bacterial burden in tissues (liver, spleen) at various timepoints

  • Histopathological examination of infected tissues

  • Immune response analysis (cytokine profiles, antibody production)

• Sampling Timepoints:

  • Early infection (1-3 days post-infection)

  • Acute phase (5-7 days post-infection)

  • Resolution/persistence phase (>10 days post-infection)

This model has been successfully used to assess the role of virulence genes in Salmonella Gallinarum, as demonstrated by studies with the wecB gene . For yciB studies, similar approaches would be appropriate, with specific attention to parameters related to bacterial replication and tissue colonization.

For comprehensive analysis, researchers should consider comparing wild-type Salmonella Gallinarum with yciB knockout mutants to determine the specific contribution of this protein to virulence and host colonization.

How do mutations in yciB affect Salmonella gallinarum virulence and host colonization?

While specific data on yciB mutations in Salmonella gallinarum is not directly presented in the search results, insights can be drawn from studies of other bacterial septation proteins and virulence factors. Based on related research, the following effects would be anticipated:

Potential Phenotypic Effects of yciB Mutations:

For reference, studies on the wecB gene in Salmonella Gallinarum demonstrated that mutation of this virulence factor significantly attenuated pathogenicity in chickens, with mutant strains showing:

• No mortality in infected chickens (compared to 100% mortality with wild-type)

• Significantly lower bacterial counts in liver and spleen

• Reduced expression of pro-inflammatory cytokines (IL-1β, TNF-α, CXCLi1)

Researchers investigating yciB should employ similar methodologies, comparing wild-type and mutant strains for:

What roles might yciB play in antimicrobial resistance mechanisms in Salmonella gallinarum?

The relationship between yciB and antimicrobial resistance (AMR) has not been directly established in the provided search results, but several theoretical connections can be proposed based on available data:

Potential AMR Associations of yciB:

• Membrane Integrity and Permeability:

  • As a membrane protein involved in septation, yciB may influence membrane permeability

  • Alterations in yciB expression or function could potentially affect antimicrobial entry into bacterial cells

  • Septation defects may alter susceptibility to cell wall-targeting antibiotics

• Relationship to Known AMR Mechanisms:

  • Genomic analysis of Salmonella Gallinarum has identified antimicrobial resistance genes (ARGs) in 41.5% of strains, with 40.4% exhibiting multi-drug resistance

  • While yciB is not directly classified as an ARG, its function in maintaining cellular integrity may indirectly contribute to survival under antimicrobial pressure

• Potential Research Approaches:

  • Compare antimicrobial susceptibility profiles between wild-type and yciB mutant strains

  • Investigate whether yciB expression changes in response to antimicrobial exposure

  • Examine the distribution and conservation of yciB across strains with different AMR profiles

To assess potential relationships between yciB and AMR, researchers could:

• Perform antimicrobial susceptibility testing on wild-type and yciB mutant strains

• Examine yciB expression levels in the presence of sub-inhibitory concentrations of various antibiotics

• Analyze correlations between yciB sequence variants and AMR profiles across Salmonella Gallinarum isolates

How might yciB be utilized in the development of novel vaccines against Salmonella gallinarum?

The potential application of yciB in vaccine development can be considered from multiple angles, drawing parallels from successful approaches with other Salmonella Gallinarum proteins:

Potential Vaccine Development Strategies:

• Live-Attenuated Vaccine Approach:

  • Create yciB mutant strains with attenuated virulence but preserved immunogenicity

  • Evaluate persistence and colonization patterns similar to studies with wecB mutants, which showed persistent low-level colonization for up to 25 days post-infection

  • Assess protective immunity following vaccination

• Recombinant Protein Subunit Vaccine:

  • Utilize purified recombinant yciB protein as an antigen

  • Evaluate appropriate adjuvant combinations

  • Determine optimal dosage and administration routes

• Vector Vaccine Platform:

  • Engineer attenuated Salmonella strains to express modified or heightened levels of yciB

  • Consider combination with other protective antigens for broader protection

For context, the search results describe a recombinant Salmonella gallinarum vaccine (SG102) expressing APEC type I fimbriae that provided protection against both Salmonella gallinarum and APEC challenges. The vaccine demonstrated significant protective effects with survival rates of 65% and 60% against challenges with APEC virulent strains O78 and O161, respectively .

To evaluate vaccine candidates, researchers should assess:

• Safety profile in target species

• Immunogenicity (both humoral and cellular immune responses)

• Protective efficacy against virulent challenge

• Duration of immunity

• Practical aspects (stability, administration route, cost)

What are the key outstanding questions regarding yciB function in bacterial pathogenesis?

Despite the available information on yciB, several critical questions remain unanswered about its precise role in bacterial pathogenesis:

• Molecular Mechanism:

  • What is the exact molecular function of yciB in the septation process?

  • How does yciB interact with other cell division proteins like FtsA and FtsZ?

  • Does yciB have secondary functions beyond septation that influence virulence?

• Regulation Networks:

  • What environmental signals regulate yciB expression during infection?

  • How is yciB expression coordinated with other virulence factors?

  • Does yciB expression vary across different host tissues?

• Host-Pathogen Interface:

  • Does yciB directly interact with host factors during infection?

  • How does yciB contribute to bacterial survival within host cells?

  • Could yciB be recognized by the host immune system?

• Therapeutic Potential:

  • Is yciB a viable target for novel antimicrobial development?

  • Could inhibition of yciB function attenuate Salmonella gallinarum infection?

  • What would be the effects of yciB-targeted interventions on bacterial physiology?

Future research should employ multidisciplinary approaches including structural biology, comparative genomics, transcriptomics, and advanced imaging techniques to address these questions.

How could advanced technologies enhance our understanding of yciB function and applications?

Emerging technologies offer promising avenues for deeper insights into yciB function:

Cutting-Edge Approaches for yciB Research:

• CRISPR-Cas9 Gene Editing:

  • Create precise modifications to study specific domains

  • Generate conditional knockdowns to study essential functions

  • Implement CRISPR interference (CRISPRi) for temporal control of yciB expression

• Advanced Microscopy Techniques:

  • Super-resolution microscopy to visualize yciB localization during cell division

  • Live-cell imaging to track dynamics in real-time

  • Correlative light and electron microscopy to link function with ultrastructure

• Structural Biology Approaches:

  • Cryo-electron microscopy to determine yciB structure in membrane context

  • Hydrogen-deuterium exchange mass spectrometry to map protein interactions

  • Molecular dynamics simulations to predict functional mechanisms

• Multi-Omics Integration:

  • Combine transcriptomics, proteomics, and metabolomics to understand systemic effects

  • Single-cell approaches to capture heterogeneity in bacterial populations

  • Systems biology modeling to predict yciB function in different contexts

• In Vivo Technologies:

  • Intravital microscopy to visualize bacterial behavior in live hosts

  • Tissue-specific gene expression analysis in infected hosts

  • Organoid models to study host-pathogen interactions in controlled environments

Implementation of these technologies could resolve current knowledge gaps and accelerate both fundamental understanding and applied research related to yciB function.