Recombinant Salmonella gallinarum Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella gallinarum Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

Recombinant Salmonella gallinarum Probable Ubiquinone Biosynthesis Protein UbiB (ubiB) is a genetically engineered protein derived from the bacterium Salmonella gallinarum. This protein is involved in the biosynthesis of ubiquinone, also known as coenzyme Q, which plays a crucial role in the electron transport chain and energy production within bacterial cells. Despite the lack of specific literature directly referencing the recombinant form of UbiB from Salmonella gallinarum, understanding its function can be inferred from studies on similar proteins in related bacteria like Salmonella enterica serovar Typhimurium.

Role of UbiB in Ubiquinone Biosynthesis

UbiB is part of the ubiquinone biosynthesis pathway, which is essential for the production of coenzyme Q8 (Q8) in bacteria. This pathway involves several enzymes, including UbiE, UbiJ, and UbiB, which work together to synthesize Q8. In Salmonella enterica serovar Typhimurium, UbiB is critical for Q8 biosynthesis and aerobic growth, as mutants lacking functional UbiB exhibit severe growth defects under aerobic conditions .

Table: Key Proteins Involved in Ubiquinone Biosynthesis

ProteinFunction in Ubiquinone Biosynthesis
UbiEInvolved in the methylation steps
UbiJRequired for aerobic Q8 biosynthesis
UbiBEssential for the synthesis of Q8

Importance of Ubiquinone Biosynthesis in Salmonella

Ubiquinone biosynthesis is vital for the survival and virulence of Salmonella species. It supports aerobic respiration, which is necessary for intracellular proliferation within host cells like macrophages . Mutants deficient in UbiB, UbiE, or UbiJ show impaired growth under aerobic conditions and reduced virulence due to their inability to efficiently produce Q8 .

Table: Growth Characteristics of UbiB Mutants

ConditionWild-Type GrowthUbiB Mutant Growth
Aerobic ConditionsNormalSeverely Impaired
Anaerobic ConditionsNormalImpaired

References

  1. Recombinant Full Length Salmonella Gallinarum Upf0442 Protein Yjjb(Yjjb) Protein, His-Tagged. Creative BioMart.

  2. ubiJ, a New Gene Required for Aerobic Growth and Proliferation in.... Journal of Bacteriology.

  3. ubiJ, a New Gene Required for Aerobic Growth and Proliferation in Macrophage, Is Involved in Coenzyme Q Biosynthesis in Escherichia coli and Salmonella enterica Serovar Typhimurium. PMC.

  4. Recombinant Full Length Salmonella Gallinarum Upf0114 Protein Yqha(Yqha) Protein, His-Tagged. Creative BioMart.

  5. Salmonella enterica serovar Gallinarum requires the.... PubMed.

  6. The UbiK protein is an accessory factor necessary for bacterial ubiquinone (UQ) biosynthesis and forms a complex with the UQ biogenesis factor UbiJ. PMC.

  7. Recombinant Salmonella gallinarum (S. gallinarum) Vaccine.... PubMed.

  8. Use of membrane proteins from Salmonella gallinarum for.... PubMed.

  9. Recombinant Salmonella mtgA Protein (aa 1-242) (strain 287/91.... Creative Biolabs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; SG3479; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVDA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPSWLMVGGVVVWLV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links

KEGG: seg:SG3479

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella gallinarum Probable ubiquinone biosynthesis protein UbiB?

Recombinant Salmonella gallinarum UbiB is a full-length protein (546 amino acids) produced through heterologous expression systems, typically E. coli, for research purposes. The native protein functions as a probable protein kinase involved in ubiquinone (coenzyme Q) biosynthesis within Salmonella gallinarum strain 287/91 (NCTC 13346). The recombinant version is commonly produced with an N-terminal histidine tag to facilitate purification and detection in laboratory settings. This protein is classified as a transmembrane protein and plays a role in the electron transport chain and cellular respiration processes . The recombinant form allows researchers to study the protein's biochemical properties, structure, and function outside the native bacterial context.

How is recombinant UbiB typically produced for research purposes?

Production of recombinant Salmonella gallinarum UbiB follows standard molecular biology protocols with specific optimizations:

  • Expression System Selection: Most commonly produced in E. coli expression systems, as indicated in the product specifications . This heterologous system allows for high-yield protein expression under controllable conditions.

  • Vector Construction: The full-length ubiB gene (nucleotides encoding amino acids 1-546) is cloned into an expression vector containing:

    • An N-terminal histidine tag sequence (typically 10xHis)

    • Appropriate promoter (often T7 or similar inducible promoter)

    • Selection markers for transformation verification

  • Transformation and Expression: The recombinant vector is transformed into E. coli expression strains (commonly BL21(DE3) or derivatives). Expression is induced using IPTG or other inducers depending on the vector design.

  • Purification Process:

    • Bacterial lysis (sonication or chemical methods)

    • Affinity chromatography using Ni-NTA or similar matrices that bind the His-tag

    • Elution with imidazole-containing buffers

    • Buffer exchange to remove imidazole

  • Product Formulation: The purified protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, available in either liquid form or as a lyophilized powder .

What are the storage and stability considerations for recombinant UbiB?

Proper storage of recombinant Salmonella gallinarum UbiB is crucial for maintaining its structural integrity and biological activity:

Storage FormRecommended StorageShelf LifeConsiderations
Liquid-20°C/-80°C6 monthsAvoid repeated freeze-thaw cycles
Lyophilized-20°C/-80°C12 monthsMore stable than liquid form

For working with the protein:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • For working aliquots, store at 4°C for up to one week

The shelf life depends on multiple factors including buffer composition, storage temperature, and the intrinsic stability of the protein itself. Trehalose (6%) is included in the formulation buffer to enhance stability during freeze-thaw cycles.

What molecular techniques can be used to study UbiB function in Salmonella gallinarum?

Several advanced molecular approaches can be employed to elucidate UbiB function:

  • Gene Knockout Studies:

    • λ-Red recombination technology allows for precise deletion of the ubiB gene

    • Creation of isogenic markerless knockout mutants permits direct comparison with wild-type strains

    • PCR verification using specific primers flanking the ubiB region confirms successful knockouts

  • Complementation Assays:

    • Reintroduction of functional ubiB on plasmids to knockout strains

    • Analysis of phenotype restoration confirms gene function

    • Use of inducible promoters allows titration of expression levels

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation using antibodies against the His-tag

    • Bacterial two-hybrid systems to identify interaction partners

    • Cross-linking studies followed by mass spectrometry

  • Enzymatic Activity Assays:

    • In vitro kinase assays using purified recombinant UbiB

    • Analysis of ubiquinone biosynthesis pathway intermediates by HPLC

    • Competitive inhibition studies to map the active site

  • Structural Biology Approaches:

    • X-ray crystallography of purified UbiB

    • Cryo-EM for membrane-associated conformations

    • Computational modeling based on homologous proteins

How does genetic manipulation of Salmonella gallinarum, such as UbiB modification, affect bacterial pathogenicity?

While the search results don't directly address UbiB deletion effects, they provide insights into genetic engineering approaches in Salmonella Gallinarum that can be applied to UbiB research:

  • Attenuation Strategies:
    The purB gene deletion in Salmonella Gallinarum demonstrates how targeted gene disruption can attenuate virulence. This approach using λ-Red recombination technology could be applied to ubiB .

  • Metabolic Impact Assessment:

    • Growth rate comparisons between wild-type and knockout strains

    • UbiB deletion would likely affect ubiquinone synthesis, impacting the electron transport chain

    • Supplementation experiments could determine if external metabolites restore growth

  • Virulence Evaluation Protocol:
    Based on the purB study methodology, UbiB function could be assessed through:

    • In vivo pathogenicity testing in 3-day-old chickens

    • Monitoring mortality rates, clinical signs, and lesion scores

    • Bacterial persistence in tissues (e.g., liver, spleen) over time

    • Clearance rate determination via tissue sampling and PCR detection

  • Quantitative Assessment:
    The following parameters would provide measurable outcomes:

    • Reduction in growth rate compared to wild-type (purB deletion showed 66.5% reduction)

    • Clinical sign scores (on a defined scale, e.g., 0-3)

    • Lesion scores in affected tissues

    • Bacterial load quantified as log10 CFU/g of tissue

What are the potential applications of recombinant UbiB and UbiB mutants in vaccine development?

Recombinant UbiB protein and engineered Salmonella strains with ubiB modifications have several potential vaccine applications:

  • Live Attenuated Vaccine Development:

    • Creation of Salmonella gallinarum strains with ubiB deletion or modification

    • Safety assessment through pathogenicity studies in target species

    • Evaluation of immune response and protection against challenge

  • Subunit Vaccine Approaches:

    • Use of purified recombinant UbiB as a vaccine antigen

    • Formulation with appropriate adjuvants

    • Delivery system optimization for poultry vaccination

  • Comparative Advantage Assessment:
    Based on the purB knockout study, a ubiB-modified live attenuated vaccine might offer:

    • Reduced clinical signs compared to wild-type infection

    • Efficient clearance from tissues (14 days post-inoculation)

    • Zero mortality compared to wild-type challenge

  • Cross-Protection Potential:

    • Evaluation against different Salmonella serovars

    • Assessment of immune response using serological tests like Rapid Plate Agglutination

  • Regulatory Considerations:

    • All recombinant DNA research, including vaccine development with modified Salmonella strains, must comply with NIH Guidelines

    • IBC (Institutional Biosafety Committee) approval required prior to starting projects

    • Additional requirements for non-exempt work

How can researchers verify the functional integrity of recombinant UbiB?

Verifying functional integrity of recombinant Salmonella gallinarum UbiB requires multi-faceted approaches:

  • Structural Integrity Assessment:

    • SDS-PAGE analysis to confirm protein size (>90% purity standard)

    • Western blotting using anti-His antibodies or specific anti-UbiB antibodies

    • Circular dichroism spectroscopy to evaluate secondary structure elements

    • Limited proteolysis to assess proper folding

  • Enzymatic Activity Verification:

    • Kinase activity assays using potential substrates

    • ATP binding and hydrolysis measurements

    • Monitoring ubiquinone production in complementation assays

  • Functional Complementation:

    • Introduction of recombinant UbiB into UbiB-deficient strains

    • Restoration of growth in minimal media

    • Recovery of ubiquinone biosynthesis pathway function

  • Binding Partner Interactions:

    • Surface plasmon resonance to quantify interactions with known partners

    • Pull-down assays using the His-tag to identify in vivo binding partners

    • Fluorescence polarization for ligand binding studies

How does UbiB function compare across different Salmonella species and other bacteria?

Comparative analysis of UbiB across bacterial species provides evolutionary and functional insights:

SpeciesUbiB HomologyNotable DifferencesFunctional Implications
S. gallinarum (287/91)Reference (546 aa)-Host-specific pathogen of poultry
S. paratyphi BHigh similarityMinor amino acid substitutionsHuman pathogen, different host tropism
S. enteritidisHigh similarityDifferences in transmembrane regionsMajor cause of food-borne infections
S. pullorumVery high similarityFew substitutionsClosely related to S. gallinarum
E. coliModerate similarityDifferences in kinase domainModel organism for UbiB function studies

Research approaches for comparative studies:

  • Sequence alignment and phylogenetic analysis of UbiB proteins

  • Expression of heterologous UbiB proteins in a common host

  • Cross-complementation studies between species

  • Metabolic profiling of ubiquinone biosynthesis across species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.