Recombinant Salmonella gallinarum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Salmonella gallinarum Prolipoprotein diacylglyceryl transferase (Lgt) is a bacterial enzyme critical for post-translational modification of lipoproteins. It catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of a conserved cysteine residue in prolipoproteins, anchoring them to the membrane . This enzymatic step is essential for bacterial viability and virulence, as lipoproteins are integral to membrane stability, nutrient uptake, and host-pathogen interactions .

Biological Role and Functional Significance

Key Functions of Lgt:

  • Lipoprotein Biosynthesis: Lgt initiates the three-step maturation of bacterial lipoproteins, enabling their membrane localization .

  • Pathogenicity: In Salmonella gallinarum, lipoproteins contribute to bile acid resistance and systemic infection in poultry .

  • Structural Conservation: Lgt enzymes across Gram-negative and Gram-positive bacteria share a signature motif (YxxNGRxxE), with residues Y26, N146, and G154 being indispensable for activity .

Topology:

  • Lgt is an inner membrane protein with seven transmembrane helices, an N-terminal periplasmic domain, and a cytoplasmic C-terminus .

3.1. Expression and Purification

Recombinant S. gallinarum Lgt (UniProt ID: B5RDX8) is produced in yeast or E. coli systems. Key specifications include:

ParameterDetails
Expression SystemYeast (Pichia pastoris)
TagDetermined during production (e.g., His-tag, GST)
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; -20°C or -80°C
Sequence291 amino acids (residues 1–291)

3.2. Biochemical Properties

  • Molecular Mass: ~32 kDa (calculated) .

  • Catalytic Activity: Requires phosphatidylglycerol as a lipid donor .

  • Stability: Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C for ≤1 week .

4.1. Role in Salmonella gallinarum Pathogenesis

  • SPI-14 Deletion Mutants: S. gallinarum lacking SPI-14 (which includes virulence-associated genes) showed reduced bile acid resistance and attenuated systemic infection in chickens .

  • Lipoprotein-Dependent Immune Evasion: Lgt-modified lipoproteins modulate host cytokine responses (e.g., IL-1β, TNF-α) .

4.2. Inhibitor Studies

  • Therapeutic Targeting: Lgt inhibitors (e.g., macrocycles G2823/G2824) disrupt lipoprotein biogenesis, increasing bacterial sensitivity to antibiotics and serum killing .

  • Mechanism: Inhibitors block diacylglyceryl transfer, leading to accumulation of unmodified prolipoproteins and outer membrane destabilization .

Comparative Analysis of Lgt Across Bacterial Species

FeatureS. gallinarum Lgt E. coli Lgt Staphylococcus aureus Lgt
Length291 residues297 residues279 residues
Identity-100% (vs. E. coli)24% identity to E. coli
Essential ResiduesY26, N146, G154 Y26, N146, G154 Conserved catalytic motif
Membrane Topology7 transmembrane domains 7 transmembrane domains Similar hydropathic profile

Implications for Vaccine Development

  • Attenuated Strains: S. gallinarum mutants with deleted SPI-14 or wecB (involved in enterobacterial common antigen synthesis) show promise as live-attenuated vaccines due to reduced virulence and persistent colonization .

  • Immune Response: Vaccination with attenuated strains induces protective immunity by moderating pro-inflammatory cytokines (e.g., CXCLi1, IFN-γ) .

Future Directions

  • Structural Studies: High-resolution crystallography of S. gallinarum Lgt could reveal targetable sites for inhibitor design .

  • Host-Specific Adaptations: Investigating Lgt’s role in S. gallinarum’s poultry tropism may inform species-specific antimicrobial strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
lgt; SG2910; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function

This recombinant Salmonella gallinarum Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links

KEGG: seg:SG2910

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of prolipoprotein diacylglyceryl transferase (Lgt) in Salmonella gallinarum?

Prolipoprotein diacylglyceryl transferase (Lgt) in Salmonella gallinarum functions as an integral membrane enzyme that catalyzes the first reaction of the three-step post-translational lipid modification in bacterial lipoprotein biosynthesis. This enzyme specifically recognizes the 'lipobox' motif with the consensus sequence LVIASTVIGAS in precursor lipoproteins . Lgt transfers a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox sequence of prolipoproteins, initiating the lipid modification process that ultimately results in mature lipoproteins. These lipoproteins are crucial for various bacterial functions including maintenance of cell envelope architecture, nutrient uptake, transport, adhesion, invasion, and virulence - all fundamental to S. gallinarum's pathogenicity in poultry .

How does Lgt in Salmonella gallinarum compare structurally to Lgt in other bacterial species like E. coli?

While specific structural data for S. gallinarum Lgt is not comprehensively documented in the provided search results, comparison can be made with the well-characterized E. coli Lgt. The E. coli Lgt crystal structure, resolved at 1.9 Å resolution in complex with phosphatidylglycerol and at 1.6 Å with the inhibitor palmitic acid, reveals two distinct binding sites for substrates . The structural homology between these enzymes is likely high given the conservation of function across bacterial species.

The critical residues identified in E. coli Lgt, particularly Arg143 and Arg239, are essential for diacylglyceryl transfer activity as demonstrated through complementation studies in lgt-knockout cells . These residues are likely conserved in S. gallinarum Lgt due to their functional importance. The enzyme is predicted to facilitate substrate entry and product exit laterally relative to the lipid bilayer, a mechanism that may be preserved across species including S. gallinarum based on the conservation of transmembrane topology and catalytic sites.

What methods are used to express and purify recombinant Salmonella gallinarum Lgt for structural studies?

For expressing and purifying recombinant S. gallinarum Lgt, researchers typically employ molecular cloning techniques utilizing the Lambda red plasmid system. The process begins with extracting plasmids such as pKD46 from E. coli strains using commercial plasmid extraction kits . The lgt gene from S. gallinarum can be amplified using PCR with specifically designed primers that incorporate appropriate restriction sites.

The purification protocol generally involves:

  • Transforming the recombinant plasmid into an expression host (commonly E. coli strains optimized for protein expression)

  • Inducing protein expression under optimal conditions

  • Cell lysis using mechanical disruption or detergent-based methods

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using suitable detergents

  • Purification using affinity chromatography (typically histidine-tagged constructs with nickel resin)

  • Further purification through size exclusion chromatography to obtain homogeneous protein preparations

For structural studies, the purified protein can be reconstituted into lipid nanodiscs or detergent micelles that mimic the native membrane environment, facilitating crystallization or other structural analysis techniques .

How can Lambda-Red recombination technology be applied to generate Lgt knockout mutants in Salmonella gallinarum?

Lambda-Red recombination technology offers a precise approach for generating Lgt knockout mutants in Salmonella gallinarum. This methodology utilizes the following protocol:

  • Plasmid preparation: Extract the Lambda red plasmid pKD46 from E. coli using a commercial plasmid extraction kit such as QIAprep Spin Miniprep Kit .

  • Electrocompetent cell preparation: Prepare S. gallinarum electrocompetent cells following established protocols with modifications suited to Salmonella species .

  • Transformation: Electroporate the prepared cells with pKD46 plasmid at 1.8 kV in 1 mm cuvettes for approximately 5.7 milliseconds using EC1 on a MicroPulser electroporator, followed by recovery in SOC media .

  • Selection: Plate transformed bacteria on LB medium supplemented with appropriate antibiotics (commonly ampicillin at 100 μg/mL) to select transformants carrying the pKD46 plasmid .

  • Gene replacement: Design PCR primers containing 40-nucleotide homology extensions matching regions flanking the lgt gene and amplify a selectable antibiotic resistance marker.

  • Recombination induction: Grow transformants carrying pKD46 with L-arabinose to induce expression of the λ-Red recombinase genes.

  • Target gene deletion: Transform the PCR product into the induced cells, allowing homologous recombination to replace the lgt gene with the antibiotic resistance marker.

  • Verification: Confirm successful knockouts through PCR amplification of the target region and sequencing to verify the deletion.

  • Curing: Remove the temperature-sensitive pKD46 plasmid by growing confirmed mutants at non-permissive temperatures (42°C).

This approach creates markerless deletions that minimize polar effects on downstream genes, essential for precise functional studies of Lgt in S. gallinarum pathogenesis and vaccine development .

What are the phenotypic characteristics of Lgt-deficient Salmonella gallinarum strains and how do they differ from wild-type strains?

Lgt-deficient Salmonella gallinarum strains exhibit distinct phenotypic characteristics compared to wild-type strains. Based on studies of similar deletion mutants in Salmonella, we can infer the following phenotypic differences:

Growth characteristics:

  • Lgt-deficient strains typically show significant growth impairment in standard media, similar to the 66.5% reduction observed in S. gallinarum ΔpurB mutants

  • Growth defects are more pronounced in minimal media lacking specific supplements

  • Conditional growth can be observed when the medium is supplemented with components that bypass the metabolic pathway affected by the mutation

Virulence attenuation:

  • Significantly reduced pathogenicity in host organisms

  • Decreased ability to establish systemic infection

  • Reduced clinical signs and lesion scores in infected hosts

  • More rapid clearance from host tissues compared to wild-type strains

Membrane integrity and function:

  • Altered outer membrane composition due to improper processing of lipoproteins

  • Modified surface antigen presentation affecting host immune recognition

  • Potential changes in antibiotic susceptibility profiles due to membrane structure alterations

  • Compromised ability to withstand environmental stresses

Immunogenic properties:

  • Despite attenuated virulence, Lgt-deficient strains often retain immunogenicity

  • Potential use as live attenuated vaccine candidates due to their ability to stimulate protective immune responses without causing disease

  • Possible altered cytokine induction profile compared to wild-type strains

What in vitro assays can be used to assess the enzymatic activity of recombinant S. gallinarum Lgt?

Several in vitro assays can be employed to assess the enzymatic activity of recombinant S. gallinarum Lgt:

  • GFP-based in vitro assay: This fluorescence-based assay uses GFP-tagged prolipoproteins as substrates. The assay monitors the transfer of diacylglyceryl from phosphatidylglycerol to the substrate, resulting in changes in fluorescence properties or mobility on gel electrophoresis .

  • Radiolabeled lipid transfer assay: This classic approach uses radiolabeled phosphatidylglycerol (typically 14C or 3H-labeled) as a donor substrate. The transfer of the radiolabeled diacylglyceryl group to acceptor prolipoproteins can be quantified by scintillation counting after separation of reaction components.

  • Thin-layer chromatography (TLC) analysis: This technique separates reaction products after incubation of recombinant Lgt with phosphatidylglycerol and synthetic peptide substrates containing the lipobox motif. The transfer of diacylglyceryl groups can be visualized using appropriate staining methods or autoradiography when using radiolabeled substrates.

  • Mass spectrometry-based assays: These provide precise molecular characterization of reaction products, allowing identification of modified peptides and quantification of enzymatic activity based on the appearance of diacylglyceryl-modified substrates.

  • FRET-based assay: Using fluorescence resonance energy transfer pairs incorporated into synthetic peptide substrates, this assay can monitor conformational changes upon diacylglyceryl transfer in real-time.

Each assay offers different advantages in terms of sensitivity, throughput, and the type of information provided. Selection should be based on specific research questions and available equipment .

How do specific mutations in key residues (e.g., Arg143, Arg239) affect the catalytic activity of S. gallinarum Lgt?

Mutations in key residues such as Arg143 and Arg239, which have been identified as essential for diacylglyceryl transfer activity in E. coli Lgt, would significantly impact the catalytic function of S. gallinarum Lgt. Based on structure-function studies:

Arg143 mutations:

  • Disruption of this residue likely impairs the enzyme's ability to recognize and bind phosphatidylglycerol, the lipid donor substrate

  • In E. coli Lgt, Arg143 variants fail to complement lgt-knockout cells, indicating its critical role in enzyme function

  • Arg143 may participate in stabilizing the transition state during the catalytic reaction

  • Mutations at this position could alter the enzyme's active site geometry, preventing proper substrate alignment

Arg239 mutations:

  • Similar to Arg143, Arg239 appears to be essential for catalytic activity as demonstrated in complementation studies

  • This residue likely participates in binding the lipobox motif of prolipoproteins or in facilitating the nucleophilic attack by the cysteine residue

  • Mutations would potentially disrupt the enzyme's ability to properly position the prolipoprotein substrate

  • Alterations in charge or steric properties at this position could significantly impair catalytic efficiency

The crystal structures of E. coli Lgt reveal that these residues are positioned to participate in substrate binding and catalysis. Given the likely conservation of these key residues in S. gallinarum Lgt due to functional constraints, similar effects would be expected from equivalent mutations .

What structural features of the Lgt enzyme contribute to substrate specificity and recognition of the lipobox motif?

The structural features of Lgt that contribute to substrate specificity and lipobox motif recognition include:

  • Binding pocket architecture: The enzyme contains a specialized binding pocket that accommodates the LVIASTVIGAS consensus sequence of the lipobox motif. This pocket is likely shaped to precisely fit the side chains of these residues, with particular emphasis on the conserved cysteine residue that undergoes modification .

  • Transmembrane domains: Lgt is an integral membrane protein with multiple transmembrane helices that position the active site at the membrane interface, allowing access to both the lipid substrate in the membrane and the prolipoprotein substrate approaching from the aqueous phase .

  • Conserved charged residues: Key charged amino acids, including Arg143 and Arg239 in E. coli Lgt, create specific electrostatic interactions with substrate components. These interactions are crucial for proper orientation of both the phosphatidylglycerol donor and the acceptor prolipoprotein .

  • Lateral access channels: The enzyme structure appears to facilitate substrate entry and product exit laterally relative to the lipid bilayer, as supported by biochemical data from E. coli Lgt studies. This architectural feature enables efficient catalytic cycling without requiring complete extraction of lipid substrates from the membrane environment .

  • Conformational flexibility: Regions of the enzyme likely undergo conformational changes upon substrate binding, creating an induced fit that optimizes the positioning of the reactive groups for catalysis while maintaining specificity for the correct substrates.

These structural elements work in concert to ensure that only appropriate prolipoproteins containing the correct lipobox motif are modified, maintaining the fidelity of the lipoprotein processing pathway .

How does the crystal structure of E. coli Lgt inform our understanding of S. gallinarum Lgt function and potential inhibitor design?

The crystal structure of E. coli Lgt provides valuable insights into S. gallinarum Lgt function and inhibitor design strategies:

Functional insights:

  • The E. coli Lgt structure revealed at 1.9 Å and 1.6 Å resolution in complex with phosphatidylglycerol and palmitic acid respectively demonstrates the presence of two binding sites critical for catalytic activity . This structural arrangement likely extends to S. gallinarum Lgt.

  • The identification of critical residues like Arg143 and Arg239 through complementation studies with lgt-knockout cells provides a framework for understanding the catalytic mechanism in S. gallinarum Lgt .

  • The structural data suggests a mechanism whereby substrate and lipid-modified product enter and exit the enzyme laterally relative to the lipid bilayer. This lateral access model is likely conserved in S. gallinarum Lgt, informing our understanding of how the enzyme functions within the bacterial membrane .

Inhibitor design implications:

  • The palmitic acid binding site identified in the E. coli Lgt structure offers a template for designing competitive inhibitors that could target the equivalent site in S. gallinarum Lgt.

  • Understanding the phosphatidylglycerol binding pocket enables structure-based design of substrate analogs that could compete with the natural lipid donor.

  • Knowledge of the binding mode and interactions with the lipobox motif allows for the development of peptide-based inhibitors that mimic the prolipoprotein substrate but resist modification.

  • The lateral access mechanism suggests that effective inhibitors need appropriate physicochemical properties to access the active site through the membrane environment.

This structural information provides a foundation for rational drug design targeting S. gallinarum Lgt, potentially leading to novel antimicrobials against fowl typhoid or tools for studying lipoprotein processing in this pathogen .

How does Lgt modification affect the immunogenicity of Salmonella gallinarum as a potential vaccine vector?

Lgt modification significantly impacts the immunogenicity of Salmonella gallinarum as a potential vaccine vector through several mechanisms:

  • Altered lipoprotein processing: Modification of Lgt affects the proper processing of bacterial lipoproteins, which serve as pathogen-associated molecular patterns (PAMPs) recognized by host pattern recognition receptors (PRRs). This altered recognition can modulate the initial innate immune response, potentially enhancing or reducing specific aspects of immunity.

  • Modified surface antigen presentation: Lipoproteins constitute important surface antigens. Changes in Lgt function alter the presentation of these antigens to the host immune system, potentially exposing normally hidden epitopes or masking typically exposed ones.

  • Balanced attenuation and immunogenicity: Successful vaccine vectors require sufficient attenuation to ensure safety while maintaining immunogenicity. Lgt modifications can be calibrated to achieve this balance, similar to what has been observed with other attenuated Salmonella strains such as the ΔpurB mutant which shows significantly reduced virulence (zero mortality compared to 80% with wild-type) while presumably maintaining immunogenic properties .

  • Differential cytokine induction: Modified lipoproteins resulting from Lgt alterations can trigger different cytokine profiles compared to wild-type strains. This differential stimulation can be leveraged to skew immune responses toward more protective profiles (e.g., Th1 versus Th2).

  • Adjuvant effect: Bacterial lipoproteins have natural adjuvant properties through TLR2 stimulation. Modifying Lgt can enhance this adjuvant effect, potentiating immune responses to co-delivered heterologous antigens.

When engineering S. gallinarum as a vaccine vector, researchers can strategically modify Lgt to optimize the balance between safety and immunogenicity, potentially creating more effective vaccines against fowl typhoid or using S. gallinarum as a delivery vehicle for heterologous antigens .

What advantages does a recombinant S. gallinarum strain with modified Lgt offer compared to conventional attenuated strains like the 9R vaccine?

A recombinant S. gallinarum strain with modified Lgt offers several distinct advantages compared to conventional attenuated strains like the 9R vaccine:

Well-defined genetic basis:

  • The genetic modifications in Lgt are precisely characterized, unlike the undefined genotype of the 9R vaccine strain that has raised concerns among researchers

  • This defined genetic basis allows for better prediction of phenotypic characteristics and behavior in host organisms

  • Regulatory agencies increasingly prefer vaccines with well-characterized genetic modifications

Customizable attenuation level:

  • The degree of attenuation can be fine-tuned by specific modifications to Lgt, allowing researchers to balance safety and immunogenicity

  • This contrasts with the 9R strain, which has been noted to retain residual virulence that can lead to safety concerns

Improved safety profile:

  • Strategically modified Lgt strains can potentially eliminate the residual virulence observed in conventional strains

  • Similar to other genetically defined mutants like ΔpurB, an Lgt-modified strain would likely show reduced clinical signs and lesion scores compared to wild-type strains

  • Enhanced clearance from host tissues can be engineered, preventing long-term persistence observed with some conventional vaccine strains

Superior immune response:

  • Modified Lgt affects lipoprotein processing, potentially enhancing both humoral and cellular immune responses

  • Unlike inactivated vaccines that primarily stimulate antibody production but not significant cellular immunity, live attenuated strains with modified Lgt could generate more balanced and comprehensive immunity

Marker capabilities:

  • Lgt modifications can be designed to serve as markers, allowing differentiation between vaccinated and infected animals (DIVA strategy)

  • This feature is particularly valuable for disease surveillance and eradication programs

The development of such recombinant strains addresses the limitations of the 9R vaccine strain, which despite contributing to reducing disease prevalence, has been criticized for its incomplete immunity, residual virulence, and undefined genotype .

What in vivo experimental models are most appropriate for evaluating the efficacy of recombinant S. gallinarum strains with modified Lgt?

For evaluating the efficacy of recombinant S. gallinarum strains with modified Lgt, several in vivo experimental models can be employed, with specific advantages for different research questions:

Chicken infection model:
This is the gold standard model as S. gallinarum is host-specific to poultry and causes fowl typhoid in these natural hosts.

Implementation protocol:

  • Use Salmonella-negative day-old chickens, preferably divided into at least three groups: modified Lgt strain group, wild-type challenge group, and negative control group

  • Administer the recombinant strain orally at an appropriate dose (e.g., 2 × 10^8 CFU per bird in 100 μL PBS)

  • Monitor birds for clinical symptoms, weight changes, and mortality over a 28-day observation period

  • Conduct post-mortem examinations to assess gross lesions in organs, particularly the liver and spleen

  • Perform bacteriological examination of organs at various time points (3, 7, 10, 14, and 21 days post-infection) to assess bacterial persistence

  • Challenge vaccinated birds with virulent wild-type S. gallinarum to evaluate protective efficacy

Age-stratified models:
Evaluating efficacy across different age groups is important as fowl typhoid affects poultry of all ages.

  • Test the vaccine in day-old chicks to assess safety and efficacy in highly susceptible populations

  • Evaluate in pullets to assess protection during the growing phase

  • Test in adult laying hens to determine effects on egg production and vertical transmission

Immunological assessment models:
These focus on detailed immune response characterization.

  • Collect serum samples at regular intervals to measure antibody responses using ELISA

  • Isolate peripheral blood mononuclear cells (PBMCs) for T-cell proliferation assays

  • Assess cytokine profiles in both serum and at the local intestinal level

  • Evaluate cellular immune responses through immunohistochemistry of lymphoid tissues

Transmission studies:
Implementing controlled housing with:

  • Direct contact between vaccinated and unvaccinated birds

  • Environmental sampling to assess shedding patterns

  • Long-term studies to evaluate herd immunity effects

These experimental models provide comprehensive data on safety, immunogenicity, and protective efficacy of recombinant S. gallinarum strains with modified Lgt, facilitating the development of improved vaccines against fowl typhoid .

What molecular techniques can differentiate between wild-type S. gallinarum and recombinant Lgt-modified strains in field samples?

Several molecular techniques can effectively differentiate between wild-type S. gallinarum and recombinant Lgt-modified strains in field samples:

PCR-based detection:

  • Conventional PCR with targeted primers: Design primers flanking the modified lgt region to generate amplicons of different sizes between wild-type and recombinant strains. This approach can clearly distinguish deletion mutants from wild-type strains based on fragment size differences .

  • Multiplex PCR: Develop a multiplex PCR system using multiple primer sets that simultaneously amplify the modified lgt region and control regions, providing internal validation while differentiating strain types.

  • Real-time PCR with specific probes: Design TaqMan or molecular beacon probes specific to either wild-type lgt sequences or the engineered junctions in modified strains, allowing quantitative differentiation.

Restriction Fragment Length Polymorphism (RFLP):
Similar to the approach used to differentiate S. Gallinarum from S. Pullorum through fliC gene restriction , engineer the lgt modification to introduce or remove specific restriction sites. The resulting restriction pattern after enzymatic digestion of PCR products can distinguish between wild-type and recombinant strains.

Whole Genome Sequencing (WGS):
For definitive characterization, WGS provides comprehensive differentiation by capturing the exact genetic modifications and confirming the absence of unintended mutations. This approach is particularly valuable for regulatory approval of vaccine strains.

Loop-mediated isothermal amplification (LAMP):
Develop LAMP assays targeting the modified lgt region for rapid field detection without sophisticated laboratory equipment, enabling point-of-care differentiation in resource-limited settings.

Digital PCR:
For extremely sensitive detection and absolute quantification, digital PCR can detect and differentiate minimal amounts of wild-type or recombinant strains, particularly useful for environmental monitoring or detecting low-level persistence.

These molecular techniques enable reliable differentiation between wild-type S. gallinarum and recombinant Lgt-modified strains in various contexts, from laboratory research to field surveillance and vaccine efficacy studies .

How can structural analysis techniques be applied to verify the proper folding and membrane integration of recombinant Lgt in S. gallinarum?

Structural analysis techniques can be systematically applied to verify proper folding and membrane integration of recombinant Lgt in S. gallinarum:

Membrane protein extraction and characterization:

  • Differential detergent solubilization: Using a series of detergents with varying properties to extract Lgt from membranes, providing information about its membrane integration state. Properly folded and integrated Lgt requires specific detergent types for efficient solubilization.

  • Sucrose density gradient centrifugation: This technique separates membrane proteins based on their association with different membrane fractions, helping to confirm the correct localization of Lgt in the bacterial membrane.

Spectroscopic techniques:

  • Circular Dichroism (CD) spectroscopy: Provides information about secondary structure content and proper folding of the purified protein. Comparison with wild-type protein CD spectra can reveal structural differences.

  • Fluorescence spectroscopy: When combined with site-specific fluorescent labeling, this technique can provide information about local environments within the protein structure and conformational changes upon substrate binding.

  • Fourier-transform infrared spectroscopy (FTIR): Particularly useful for membrane proteins, FTIR can assess secondary structure in membrane-mimetic environments.

Advanced structural analysis:

  • X-ray crystallography: The gold standard for high-resolution structural determination, as demonstrated with E. coli Lgt . Crystallization of membrane proteins requires specialized techniques using lipidic cubic phases or detergent micelles.

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structural determination without crystallization, potentially revealing Lgt structure in more native-like environments.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique maps solvent accessibility of protein regions, providing insights into folding and membrane integration without requiring crystallization.

Functional verification:

  • Enzymatic activity assays: Confirm proper folding through activity measurements using techniques such as the GFP-based in vitro assay , which directly correlates structure with function.

  • Thermal shift assays: Assess protein stability and proper folding by monitoring unfolding transitions under thermal stress.

These complementary approaches provide multifaceted evidence for proper folding and membrane integration of recombinant Lgt in S. gallinarum, essential for understanding structure-function relationships and developing effective vaccines or antimicrobials .

What computational approaches can predict the impact of specific mutations in S. gallinarum Lgt on enzyme function and bacterial virulence?

Computational approaches offer powerful tools for predicting how specific mutations in S. gallinarum Lgt might affect enzyme function and bacterial virulence:

Sequence-based predictions:

  • Multiple sequence alignment (MSA) and conservation analysis: Identifies evolutionary conserved residues across Lgt proteins from various bacterial species, highlighting positions likely critical for function. Mutations in highly conserved positions typically have more severe functional consequences.

  • Sequence-based machine learning algorithms: Tools like PROVEAN, SIFT, and PolyPhen can predict the functional impact of amino acid substitutions based on sequence conservation patterns and physicochemical properties.

  • Coevolution analysis: Methods such as direct coupling analysis (DCA) identify coevolving residue pairs, suggesting functional or structural relationships that might be disrupted by mutations.

Structure-based approaches:

  • Homology modeling: Using E. coli Lgt crystal structure (1.9 Å and 1.6 Å resolution) as a template , accurate structural models of S. gallinarum Lgt can be constructed to visualize mutation effects.

  • Molecular dynamics (MD) simulations: Simulate the dynamics of both wild-type and mutant Lgt proteins in membrane environments to assess structural stability, conformational changes, and substrate binding alterations. These simulations can reveal subtle effects that static structural models might miss.

  • Computational mutagenesis and binding affinity predictions: Calculate changes in thermodynamic stability (ΔΔG) and substrate binding affinity upon mutation using tools like FoldX, Rosetta, or MM-PBSA approaches.

System-level predictions:

Integrated approaches:

  • QM/MM (Quantum Mechanics/Molecular Mechanics) methods: For critical catalytic residues like Arg143 and Arg239 , these methods can provide detailed insights into how mutations affect the electronic structure and reaction mechanisms.

  • Virtual screening: Identify potential inhibitors targeting specific variants of Lgt using structure-based or ligand-based virtual screening approaches.

These computational approaches provide valuable preliminary insights, guiding experimental design and helping researchers prioritize mutations for detailed biochemical and in vivo characterization .

What are the current limitations in developing stable recombinant S. gallinarum strains with modified Lgt for vaccine purposes?

Several significant limitations currently challenge the development of stable recombinant S. gallinarum strains with modified Lgt for vaccine purposes:

Genetic stability concerns:

  • The potential for genetic reversion or compensation represents a major challenge, particularly for attenuated vaccine strains intended for field deployment

  • Selective pressure in vivo might favor the emergence of suppressor mutations that restore virulence while maintaining the engineered Lgt modification

  • Long-term stability testing under various environmental conditions is essential but time-consuming and resource-intensive

Functional balance challenges:

  • Achieving the optimal balance between attenuation and immunogenicity remains difficult, as excessive attenuation may reduce vaccine efficacy while insufficient attenuation raises safety concerns

  • Lgt modifications must disrupt virulence sufficiently without compromising bacterial viability and immunostimulatory properties

  • Strain-specific variations may necessitate customized modification strategies, limiting the transferability of successful approaches between bacterial isolates

Technical and methodological limitations:

  • Precise genetic manipulation techniques for S. gallinarum still face efficiency challenges compared to model organisms like E. coli

  • The Lambda-Red recombination system, while effective, may introduce unintended mutations or genomic rearrangements that are difficult to detect without comprehensive genomic analysis

  • Membrane protein manipulation presents inherent difficulties in expression, purification, and functional characterization

Regulatory and safety hurdles:

  • Genetically modified live vaccines face stringent regulatory requirements, necessitating extensive safety testing

  • Environmental release concerns regarding genetically modified organisms create additional regulatory barriers

  • The potential for horizontal gene transfer of modified genetic elements to other bacteria requires thorough risk assessment

Immunological complexities:

  • Limited understanding of the precise immunological mechanisms by which Lgt modifications affect protective immunity

  • Variable host responses between different poultry breeds and age groups complicate efficacy predictions

  • Ensuring cross-protection against diverse field strains remains challenging

Addressing these limitations requires integrated approaches combining advanced genetic engineering, thorough safety assessments, and comprehensive immunological characterization to develop effective and safe recombinant S. gallinarum vaccine strains .

How might targeted Lgt modifications be combined with other genetic alterations to optimize vaccine safety and efficacy?

Targeted Lgt modifications can be strategically combined with other genetic alterations to create optimized vaccine candidates with enhanced safety and efficacy profiles:

Multi-target attenuation strategy:

  • Combining Lgt modifications with disruptions in purine biosynthesis genes (like purB) could create synergistic attenuation effects while maintaining robust immunogenicity .

  • Implementing a dual-attenuation approach targeting both metabolic pathways (e.g., purB) and structural components (Lgt) reduces the likelihood of reversion to virulence through compensatory mutations.

  • This multi-target approach provides stronger safety guarantees by requiring multiple independent reversion events to restore full virulence.

Immunomodulation enhancements:

  • Coupling Lgt modifications with engineered expression of immunostimulatory molecules such as cytokines (IL-2, GM-CSF) or immune activators.

  • Incorporating mutations in regulatory genes that control the expression of multiple virulence factors, creating broad attenuation while preserving antigenic complexity.

  • Engineering the co-expression of heterologous protective antigens from other poultry pathogens to develop multivalent vaccine candidates.

Controlled persistence mechanisms:

  • Introducing regulated delayed-attenuation systems where the vaccine strain initially replicates efficiently to establish immunity before attenuation takes full effect.

  • Implementing environmentally responsive genetic switches that modulate Lgt function based on in vivo conditions.

  • Developing programmed cell death mechanisms triggered after sufficient immunization has occurred to enhance safety.

Enhanced delivery and presentation:

  • Modifying secretion systems alongside Lgt alterations to optimize antigen presentation to the host immune system.

  • Engineering changes in outer membrane structures to expose additional protective epitopes while maintaining attenuation.

  • Incorporating genetic modifications that enhance mucosal immunity induction, particularly important for enteric pathogens.

Synthetic biology approaches:

  • Designing synthetic regulatory circuits that precisely control Lgt expression levels in response to specific environmental cues.

  • Implementing CRISPR-based self-limiting mechanisms that restrict bacterial persistence beyond the desired immunization period.

  • Creating genomically recoded strains with multiple attenuating modifications distributed throughout essential pathways.

This integrated approach to vaccine design combines the benefits of Lgt modification with complementary genetic alterations to address the multifaceted challenges of developing safe, effective, and stable live attenuated vaccines .

What emerging technologies might improve our understanding of Lgt structure-function relationships in S. gallinarum and other bacterial pathogens?

Several cutting-edge technologies are poised to revolutionize our understanding of Lgt structure-function relationships in S. gallinarum and other bacterial pathogens:

Advanced structural biology techniques:

  • Cryo-electron microscopy (cryo-EM): Recent breakthroughs in resolution capabilities now allow visualization of membrane proteins like Lgt in near-native environments, potentially revealing conformational states unavailable through crystallography .

  • Microcrystal electron diffraction (MicroED): This emerging technique can determine structures from nanocrystals too small for traditional X-ray crystallography, particularly valuable for membrane proteins that often resist forming large crystals.

  • Serial femtosecond crystallography at X-ray free-electron lasers (XFELs): Enables structure determination from microcrystals at room temperature, potentially capturing physiologically relevant conformations and reaction intermediates of Lgt.

Integrative structural approaches:

  • Cross-linking mass spectrometry (XL-MS): Identifies spatial relationships between regions of Lgt and its interaction partners, providing constraints for computational modeling.

  • Native mass spectrometry: Characterizes membrane protein complexes in their native state, revealing stoichiometry and stable interaction networks.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps dynamic protein regions and conformational changes upon substrate binding or mutation.

Advanced genetic and cellular techniques:

  • CRISPR-based precise genome editing: Enables rapid generation of comprehensive mutation libraries in Lgt with minimal off-target effects, facilitating high-throughput structure-function analyses.

  • Single-cell transcriptomics and proteomics: Reveals how Lgt modifications affect bacterial heterogeneity and host responses at unprecedented resolution.

  • In-cell structural biology: Techniques like in-cell NMR provide structural information within the native cellular environment.

Computational advances:

  • AI/ML structure prediction: Tools like AlphaFold2 and RoseTTAFold can predict Lgt structures with remarkable accuracy, even for bacterial species lacking experimental structures.

  • Enhanced molecular dynamics simulations: Specialized force fields for membrane environments combined with advanced sampling techniques can simulate Lgt function over biologically relevant timescales.

  • Quantum mechanics/molecular mechanics (QM/MM): Provides insights into catalytic mechanisms at the electronic level, particularly relevant for understanding how critical residues like Arg143 and Arg239 contribute to function .

Systems biology integration:

  • Multi-omics data integration: Combines transcriptomics, proteomics, metabolomics, and structural information to place Lgt function in broader cellular contexts.

  • Pathogen-host interaction models: Integrates structural data with infection models to connect molecular-level understanding to pathogenesis.

These emerging technologies promise to deliver unprecedented insights into Lgt structure, function, and dynamics, potentially revealing new opportunities for targeted interventions against S. gallinarum and other bacterial pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.