Recombinant Salmonella gallinarum Protein CrcB homolog (crcB)

What is the CrcB homolog protein in Salmonella gallinarum and what is its function?

The CrcB homolog protein in Salmonella gallinarum (UniProt ID: B5R7X8) is a 127-amino acid protein also known as "Putative fluoride ion transporter CrcB." The protein functions primarily as a membrane channel that mediates fluoride ion export, protecting bacterial cells from fluoride toxicity. The full amino acid sequence is: MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTHIDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWLFSAAAAR . CrcB's transmembrane domain structure enables it to form channels through the cell membrane, allowing for controlled ion transport while maintaining membrane integrity.

How is recombinant Salmonella gallinarum CrcB homolog protein typically expressed and purified?

Recombinant S. gallinarum CrcB homolog protein is commonly expressed in E. coli expression systems with an N-terminal His tag to facilitate purification . The general methodology involves:

• Cloning the crcB gene into an expression vector with an N-terminal His tag

• Transforming the recombinant plasmid into E. coli expression strains

• Inducing protein expression under optimized conditions

• Cell lysis and extraction of total protein

• Purification via immobilized metal affinity chromatography (IMAC) using the His tag

• Further purification steps such as size exclusion chromatography if needed

• Confirmation of purity by SDS-PAGE (>90% purity)

• Lyophilization for long-term storage

The recombinant protein is typically stored as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the optimal storage and reconstitution conditions for recombinant CrcB protein?

The optimal storage and reconstitution protocols for recombinant CrcB protein are:

Storage conditions:

• Store lyophilized protein at -20°C or -80°C upon receipt

• Aliquot to avoid repeated freeze-thaw cycles

• Working aliquots may be stored at 4°C for up to one week

Reconstitution protocol:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

• Aliquot for long-term storage at -20°C/-80°C

Proper storage and reconstitution are critical for maintaining protein activity and structural integrity, particularly for membrane proteins like CrcB that may be prone to aggregation.

What experimental approaches can be used to study the fluoride ion transport activity of recombinant CrcB protein?

Several methodological approaches can be employed to investigate the fluoride ion transport activity of recombinant CrcB protein:

• Liposome reconstitution assays:

  • Reconstitute purified CrcB into liposomes

  • Load liposomes with fluoride-sensitive fluorophores

  • Monitor fluorescence changes upon fluoride gradient application

  • Calculate transport kinetics and ion selectivity

• Electrophysiological techniques:

  • Incorporate CrcB into planar lipid bilayers

  • Measure ion conductance using patch-clamp techniques

  • Determine channel properties including gating mechanisms

• Fluoride toxicity rescue experiments:

  • Express CrcB in fluoride-sensitive bacterial strains

  • Measure growth rates at various fluoride concentrations

  • Compare with appropriate controls (empty vector, CrcB mutants)

• Structural analysis approaches:

  • X-ray crystallography or cryo-EM to determine 3D structure

  • Molecular dynamics simulations to identify fluoride binding sites

  • Site-directed mutagenesis of key residues followed by functional assays

The combination of these approaches provides complementary insights into CrcB's transport mechanism, selectivity, and structure-function relationships.

How can CRISPR/Cas9 technology be adapted for genetic manipulation of the crcB gene in Salmonella gallinarum?

CRISPR/Cas9 technology can be adapted for genetic manipulation of the crcB gene in S. gallinarum using the following methodology:

• Design of guide RNAs (gRNAs):

  • Select target sequences within the crcB gene with minimal off-target effects

  • Design gRNA oligos with appropriate overhangs for cloning

  • Phosphorylate oligos for efficient ligation

• Construction of CRISPR/Cas9 vectors:

  • Clone phosphorylated gRNA oligos into pCas9 or pCasSA vectors using Golden Gate Assembly

  • Confirm cloning through colony PCR and Sanger sequencing

  • Design appropriate homology arms for homology-directed repair (HDR)

• Preparation of recombinant plasmids:

  • Create a donor template containing homology arms flanking the desired modification

  • Co-transform CRISPR/Cas9 and donor template plasmids into S. gallinarum

• Transformation and selection:

  • Electroporate recombinant plasmids into electrocompetent S. gallinarum cells

  • Plate on selective media with appropriate antibiotics

  • Incubate at 37°C overnight

• Screening and verification:

  • Screen transformants using colony PCR with primers binding outside the homology arms

  • Confirm gene modifications through Sanger sequencing

  • Assess protein expression changes through Western blotting

This approach has been successfully used for virulence gene deletion in S. gallinarum , suggesting its adaptability for crcB manipulation.

What are the challenges and solutions for expressing membrane proteins like CrcB homolog in heterologous systems?

Challenges and solutions for expressing membrane proteins like CrcB:

Successful expression of functional CrcB requires careful optimization of these parameters, with particular attention to maintaining the protein's native conformation throughout the expression and purification process.

What analytical methods are most effective for characterizing the structure-function relationship of CrcB protein?

Multiple analytical approaches can be integrated to comprehensively characterize the structure-function relationship of CrcB protein:

• Circular Dichroism (CD) Spectroscopy:

  • Provides information about secondary structure content

  • Monitors structural changes under different conditions (pH, temperature)

  • Requires 0.1-0.5 mg/ml protein in detergent micelles or nanodiscs

• Fluorescence Spectroscopy:

  • Exploits intrinsic tryptophan fluorescence to monitor conformational changes

  • Can be used to study ligand binding by measuring fluorescence quenching

  • Useful for determining binding affinities and stoichiometry

• Cryo-Electron Microscopy:

  • Enables visualization of protein structure in near-native environment

  • Can resolve transmembrane domains and ion channels

  • Preparation requires specialized techniques for membrane proteins

• Molecular Dynamics Simulations:

  • Models protein behavior in membrane environments

  • Identifies potential ion permeation pathways

  • Simulates conformational changes during transport cycles

• Site-Directed Mutagenesis Combined with Functional Assays:

  • Systematically mutate conserved residues

  • Correlate structural alterations with functional outcomes

  • Create a comprehensive map of critical functional domains

By integrating these analytical approaches, researchers can develop detailed models of how CrcB's structure enables its specific fluoride transport function.

How can researchers differentiate between specific and non-specific binding when studying CrcB interaction with fluoride ions?

Differentiating between specific and non-specific binding of fluoride ions to CrcB requires a multi-faceted approach:

• Equilibrium Binding Assays:

  • Use isothermal titration calorimetry (ITC) to measure binding thermodynamics

  • Plot binding isotherms and fit to appropriate models (single-site, multiple-site)

  • Compare binding parameters (Kd, ΔH, ΔS) with control proteins

• Competition Assays:

  • Perform binding studies in the presence of other halide ions (Cl⁻, Br⁻, I⁻)

  • True specific binding shows selectivity for fluoride over other ions

  • Calculate selectivity ratios based on IC50 values

• Mutational Analysis:

  • Mutate predicted binding site residues

  • Measure changes in binding affinity and transport activity

  • Specific binding sites show significant functional impact when mutated

• Concentration-Dependent Transport Assays:

  • Measure transport rates at various fluoride concentrations

  • Plot data to determine Km and Vmax values

  • Specific transport exhibits saturation kinetics with defined parameters

• Structural Studies:

  • Use X-ray crystallography with fluoride soaking

  • Identify specific fluoride binding sites in the protein structure

  • Compare with structures obtained in the absence of fluoride

These complementary approaches provide robust evidence to distinguish specific fluoride binding sites essential for transport function from non-specific interactions.

How do mutations in the crcB gene affect Salmonella gallinarum survival under different environmental conditions?

Mutations in the crcB gene likely affect S. gallinarum survival under various environmental conditions in the following ways:

Systematic evaluation of crcB mutants under these conditions would provide valuable insights into the protein's role in bacterial physiology and environmental adaptation.

How can recombinant CrcB protein be utilized in developing diagnostic tools for Salmonella gallinarum detection?

Recombinant CrcB protein offers several avenues for developing sensitive and specific diagnostic tools for S. gallinarum detection:

• Antibody-Based Detection Systems:

  • Generate anti-CrcB antibodies using purified recombinant protein

  • Develop ELISA assays for detecting CrcB in environmental or clinical samples

  • Create lateral flow immunoassays for rapid field testing

  • Potential sensitivity enhancement through antibody engineering

• PCR-Based Detection Methods:

  • Design primers targeting unique regions of the crcB gene

  • Incorporate into multiplex real-time PCR assays alongside other S. gallinarum markers

  • Integration with existing molecular detection platforms for comprehensive testing

  • Potential detection limit of 3 CFU when optimized

• Biosensor Development:

  • Immobilize anti-CrcB antibodies on biosensor surfaces

  • Develop label-free detection systems using surface plasmon resonance

  • Create electrochemical biosensors for field-deployable diagnostics

  • Enhance sensitivity through signal amplification strategies

• Comparative Diagnostic Performance:

What are the advantages and limitations of using CrcB as a target for molecular detection of Salmonella gallinarum compared to other genetic markers?

Advantages and limitations of CrcB as a molecular detection target:

Advantages:

• Potential Specificity: The crcB sequence may contain unique regions that differentiate S. gallinarum from other Salmonella serovars

• Conserved Nature: As an ion transporter with essential function, crcB likely shows sequence conservation within S. gallinarum strains

• Complementary Target: Can be incorporated into multiplex assays alongside established targets like SGP gene segment and glgC

• Functional Correlation: Detection of functional genes provides information about potential bacterial physiology

Limitations:

• Sequence Similarity: CrcB homologs exist across multiple bacterial species, requiring careful primer design

• Copy Number: Unlike plasmid-borne virulence genes with multiple copies, chromosomal genes like crcB typically exist as single copies, potentially reducing detection sensitivity

• Limited Validation: Compared to established targets like SGP and glgC , crcB has less extensive validation as a diagnostic target

• Detection Challenges: Membrane protein genes may have sequence characteristics (high GC content, repetitive elements) that complicate PCR amplification

Comparative Analysis with Established Markers:

The optimal approach would likely integrate CrcB with established markers in a comprehensive multiplex detection system, leveraging the strengths of each target.

How can recombinant CrcB protein be used in drug discovery and development of novel antimicrobials targeting Salmonella species?

Recombinant CrcB protein offers multiple avenues for antimicrobial drug discovery targeting Salmonella species:

• High-Throughput Screening Platforms:

  • Develop fluorescence-based transport assays using purified CrcB

  • Screen chemical libraries for CrcB inhibitors

  • Identify compounds that selectively block fluoride transport

  • Validate hits through secondary assays and structure-activity relationship studies

• Structure-Based Drug Design:

  • Use structural data from crystallography or cryo-EM studies of CrcB

  • Identify druggable binding pockets within the transport channel

  • Perform in silico screening to identify potential inhibitors

  • Synthesize and test promising candidates against recombinant protein

• Fluoride Mimetics Development:

  • Design fluoride analogs that bind CrcB but cannot be transported

  • Create competitive inhibitors that occupy the fluoride binding site

  • Develop irreversible inhibitors that covalently modify key residues

  • Test in bacterial growth assays for antimicrobial efficacy

• Targeted Delivery Systems:

  • Develop antibody-drug conjugates targeting exposed epitopes of CrcB

  • Create nanoparticle formulations for improved delivery to bacteria

  • Design prodrugs activated by bacterial enzymes near CrcB

  • Test in infection models for efficacy and selectivity

• Combination Therapy Approaches:

  • Identify synergistic effects between CrcB inhibitors and existing antibiotics

  • Develop dual-targeting compounds affecting CrcB and other bacterial processes

  • Test against antimicrobial-resistant Salmonella strains

  • Evaluate potential for resistance development through serial passage experiments

This research direction could yield novel antimicrobials with specific activity against Salmonella species, addressing the growing concern of antimicrobial resistance.

What comparative genomics approaches can reveal about CrcB homolog evolution and conservation across Salmonella serovars?

Comparative genomics approaches can provide significant insights into CrcB homolog evolution and conservation across Salmonella serovars:

• Phylogenetic Analysis:

  • Construct phylogenetic trees based on crcB sequences from diverse Salmonella serovars

  • Compare with species phylogeny to identify potential horizontal gene transfer events

  • Calculate evolutionary rates to identify selection pressures

  • Determine if crcB evolution correlates with host adaptation patterns

• Sequence Conservation Analysis:

  • Calculate sequence identity and similarity across Salmonella serovars

  • Identify highly conserved domains suggesting functional importance

  • Map conservation onto predicted structural models

  • Compare transmembrane domains versus cytoplasmic regions conservation patterns

• Synteny Analysis:

  • Examine genomic context of crcB across different Salmonella genomes

  • Identify conserved gene neighborhoods and potential operonic structures

  • Detect genomic rearrangements affecting crcB expression

  • Compare with other bacterial species to identify Salmonella-specific patterns

• Selective Pressure Analysis:

  • Calculate dN/dS ratios to identify purifying or positive selection

  • Perform codon-based tests for selection

  • Identify specific amino acid positions under selective pressure

  • Correlate with functional domains and predicted binding sites

• Host-Adaptation Correlation:

  • Compare crcB sequences between host-restricted serovars (like S. gallinarum) and broad-host-range serovars

  • Identify potential mutations correlating with host adaptation

  • Analyze expression patterns across different hosts

  • Develop hypotheses about CrcB's role in host-specific pathogenesis

These approaches would provide valuable evolutionary context for understanding CrcB function and potentially reveal host-specific adaptations relevant to Salmonella pathogenesis in different species.

What are the critical parameters to optimize when expressing and purifying recombinant CrcB protein for structural studies?

Optimizing expression and purification of recombinant CrcB protein for structural studies requires careful attention to multiple parameters:

• Expression System Optimization:

  • Compare bacterial (E. coli) strains specialized for membrane proteins (C41, C43, Lemo21)

  • Test different expression vectors (pET, pBAD, pMAL) with varying promoter strengths

  • Evaluate expression temperatures (16°C, 20°C, 30°C) and induction periods (4-24h)

  • Optimize inducer concentration (0.1-1.0 mM IPTG) through small-scale expression tests

• Fusion Tag Selection:

  • Compare N-terminal vs. C-terminal His-tag placement for optimal expression and activity

  • Test additional fusion partners (MBP, SUMO, GST) for improved solubility

  • Evaluate tag removal efficiency using different proteases (TEV, PreScission)

  • Assess effect of tag position on protein function through activity assays

• Membrane Extraction Optimization:

  • Compare detergent types for membrane solubilization (DDM, LMNG, UDM)

  • Test detergent concentrations (1-5x CMC) for optimal extraction efficiency

  • Optimize solubilization time (1-24h) and temperature (4°C vs. room temperature)

  • Evaluate addition of stabilizing agents (glycerol, specific lipids) during extraction

• Purification Strategy:

  • Implement multi-step purification (IMAC followed by size exclusion chromatography)

  • Optimize buffer composition (pH 7.5-8.5, salt concentration 100-500 mM)

  • Evaluate detergent exchange during purification for crystal formation

  • Incorporate quality control steps (SEC-MALS, DLS) to assess monodispersity

• Stabilization for Structural Studies:

  • Test protein reconstitution into nanodiscs or lipid cubic phase for structural studies

  • Evaluate cryoprotectants for crystal freezing and cryo-EM grid preparation

  • Optimize protein concentration (5-15 mg/ml) for crystallization trials

  • Screen additives (lipids, ligands) that may stabilize specific conformations

Careful optimization of these parameters is crucial for obtaining pure, homogeneous, and functionally active CrcB protein suitable for high-resolution structural studies.

What are common pitfalls when analyzing CrcB protein function, and how can researchers address them?

Common pitfalls and solutions in CrcB functional analysis:

Addressing these pitfalls requires rigorous experimental design with appropriate controls and validation through complementary methodologies to ensure reliable and reproducible functional analysis of CrcB protein.

How does research on CrcB homolog in Salmonella gallinarum contribute to our understanding of bacterial ion transport mechanisms?

Research on CrcB homolog in Salmonella gallinarum provides several important contributions to our broader understanding of bacterial ion transport mechanisms:

• Evolutionary Conservation of Ion Channels:

  • CrcB represents an ancient and conserved family of fluoride-specific channels

  • Comparative studies between S. gallinarum CrcB and homologs in other species reveal core functional elements of fluoride channels

  • Identification of conserved residues critical for selectivity and transport

• Structure-Function Relationships in Ion Selectivity:

  • Analysis of CrcB's selective fluoride transport illuminates general principles of ion discrimination

  • Molecular determinants of halide selectivity can be identified through mutagenesis studies

  • Contributes to understanding how channel architecture determines ion specificity

• Membrane Protein Topology and Assembly:

  • CrcB forms unique dual-topology dimers in membranes

  • Studies of S. gallinarum CrcB assembly provide insights into membrane protein biogenesis

  • Elucidates principles of transmembrane domain interactions in functional channels

• Regulatory Mechanisms in Ion Transport:

  • Investigation of CrcB regulation reveals mechanisms of bacterial ion homeostasis

  • Connection to riboswitch-mediated gene expression control systems

  • Provides model for understanding bacterial adaptation to environmental ion fluctuations

• Evolution of Host-Pathogen Interactions:

  • S. gallinarum's host-restricted nature offers opportunity to study how ion transport proteins adapt during host specialization

  • Comparison with broad-host range Salmonella provides insights into specialization of ion transport systems

  • Potential insights into how pathogens adapt ion transport mechanisms to specific host environments

This research area bridges fundamental membrane biology with bacterial physiology and pathogenesis, contributing to a comprehensive understanding of how bacteria maintain ion homeostasis in diverse environments.