Recombinant Salmonella gallinarum Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Rhomboid protease GlpG is a serine protease (EC 3.4.21.105) that catalyzes intramembrane proteolysis, a process critical for regulating membrane protein function and quality control . The recombinant form is expressed in heterologous systems like E. coli or yeast, enabling structural and functional studies .

Key Features

  • Topology: Six transmembrane domains (TMDs) with a catalytic Ser-His dyad in TMD4 .

  • Catalytic Mechanism: Water molecules in the catalytic cavity facilitate hydrolysis of substrate transmembrane helices .

  • Substrate Specificity: Targets orphan subunits of bacterial respiratory complexes (e.g., hydrogenase-2, formate dehydrogenases) with conserved proline residues in their TMDs .

Biochemical Properties

PropertyDetails
EC Number3.4.21.105
Gene NameglpG
Molecular Weight~32 kDa (full-length, 276 amino acids)
Catalytic ResiduesSer-201 and His-265 (E. coli homolog)

Production and Purification

Recombinant GlpG is typically expressed with affinity tags (e.g., His-tag) for purification. Key production details include:

Mechanistic Studies

  • Substrate Binding: Crystal structures (e.g., PDB 4QO2) reveal GlpG’s interaction with peptidyl-chloromethylketone inhibitors, mimicking natural substrates like Providencia stuartii TatA .

  • Dynamic Analysis: Solid-state NMR shows conformational flexibility in TM5, essential for substrate gating .

Pathogenesis and Metabolism

  • Gut Colonization: GlpG supports E. coli persistence in the mammalian gut by regulating fatty acid β-oxidation and glycerol degradation pathways .

  • Quality Control: Cleaves orphan subunits of respiratory complexes (e.g., HybA, FdnH) to prevent toxic aggregation .

Key Research Findings

  1. Substrate Recognition: GlpG selectively cleaves TMDs with helix-destabilizing residues (e.g., proline) . Mutation of HybA-P300 or FdnH-P259 abolishes cleavage .

  2. Regulatory Role: In Shigella sonnei, GlpG and Rhom7 coordinate to degrade unassembled respiratory complex subunits, ensuring membrane integrity .

  3. Therapeutic Potential: Inhibitor-binding studies (e.g., peptidyl-CMKs) provide templates for antimicrobial drug design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; SG3915; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: seg:SG3915

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What methodologies should be used for optimal expression and purification of Recombinant Salmonella gallinarum Rhomboid protease glpG?

For optimal expression and purification of Recombinant Salmonella gallinarum Rhomboid protease glpG, the following methodological approach is recommended:

Expression System:

  • Host organism: E. coli is the preferred expression system

  • Vector design: Incorporate an N-terminal His-tag for affinity purification

  • Expression construct: Use the full-length protein (residues 1-276) to maintain structural integrity

Purification Protocol:

  • Extract membrane proteins using appropriate detergents that maintain enzyme activity

  • Perform affinity chromatography using the His-tag

  • Consider size exclusion chromatography as a polishing step

  • Aim for >90% purity as determined by SDS-PAGE

Quality Control:

  • Verify protein identity using mass spectrometry

  • Assess purity through SDS-PAGE

  • Confirm enzymatic activity using established protease assays

For reconstitution studies in membrane-like environments, solid-state NMR spectroscopy has proven valuable for maintaining native-like activity while enabling structural studies .

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Reconstituted protein is stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Stability Considerations:

  • Avoid repeated freezing and thawing as this significantly reduces enzymatic activity

  • For enzymatic studies, consider reconstituting the protein in a native-like lipid environment, as solid-state NMR studies have shown this maintains the protein's structural integrity and function

  • When performing activity assays, maintain appropriate detergent concentrations above the critical micelle concentration

What are the known biological functions of Rhomboid protease glpG in bacterial systems and how can they be experimentally investigated?

Rhomboid protease glpG serves several biological functions in bacterial systems:

Established Functions:

  • Gut Persistence: In extraintestinal pathogenic Escherichia coli (ExPEC), GlpG promotes bacterial persistence in the mammalian gut, which is often a prerequisite for ExPEC-mediated pathogenesis

  • Metabolic Regulation: GlpG is part of the glpEGR operon and its disruption affects glpR activity, influencing glycerol degradation pathways

  • Fatty Acid Utilization: GlpG contributes to bacterial fitness in intestinal mucus by influencing pathways directly or indirectly associated with fatty acid beta-oxidation

Key Experimental Approaches for Investigation:

ApproachMethodologyApplication
Gene KnockoutCreation of ΔglpG mutants and complementation with expression plasmidsAssess phenotypic effects on growth in specific media
Competition AssaysCo-culture of wild-type and mutant strainsMeasure competitive index (CI) in relevant environments
Metabolite SupplementationAddition of glycerol-3-phosphate (G3P) to culturesTest rescue of growth defects in ΔglpG mutants
In vivo ModelsMouse gut colonization with unperturbed microbiotaEvaluate contribution to bacterial survival in natural settings
TranscriptomicsRNA-seq of wild-type vs. ΔglpG strainsIdentify affected gene expression pathways

Researchers have shown that the disruption of glpG had polar effects on the downstream gene glpR, which encodes a transcriptional repressor of factors that catalyze glycerol degradation. Both ΔglpG and ΔglpR mutants showed impaired growth in mucus and on plates containing oleate as the sole carbon source .

How do the structural dynamics of Rhomboid protease glpG relate to its enzymatic mechanism and substrate specificity?

The structural dynamics of Rhomboid protease glpG are intricately linked to its enzymatic mechanism and substrate specificity:

Key Structural Elements Affecting Function:

  • Gating Helix TM5: Solid-state NMR spectroscopy has revealed a previously unobserved kink in the central part of TM5, which is crucial for substrate access to the active site. Relaxation dispersion experiments suggest that TM5 undergoes conformational exchange between open and closed states .

  • Dynamic Hotspot: The N-terminal part of TM5 and adjacent loop L4 form a dynamic hotspot of GlpG, indicating this region's importance for the substrate gating mechanism .

  • Water Molecules in Catalytic Cavity: Proton-detected NMR experiments confirm the presence of water molecules in the catalytic cavity, essential for the hydrolysis reaction .

Substrate Recognition and Specificity:

In bacterial rhomboid proteases, substrate specificity is determined by:

  • Helix-destabilizing residues in the substrate's transmembrane domain

  • Recognition of specific amino acid sequences near the cleavage site

  • Conformational flexibility of the substrate

For example, in Bacillus subtilis, the rhomboid protease YqgP (which shares homology with GlpG) cleaves the MgtE magnesium transporter within the extracytoplasmic loop between TMH1 and TMH2, near the periplasmic end of TMH2 . This suggests that GlpG may similarly recognize and cleave substrates at specific membrane-proximal sites.

Understanding these structural dynamics is critical for designing inhibitors or engineering GlpG variants with altered substrate specificity for research applications.

What role does Rhomboid protease glpG play in bacterial metabolism, particularly in relation to glycerol utilization and fatty acid metabolism?

Rhomboid protease glpG plays a significant role in bacterial metabolism, particularly in pathways related to glycerol utilization and fatty acid metabolism:

Glycerol Metabolism Regulation:

The glpG gene is part of the glpEGR operon, which includes:

  • glpE: A thiosulfate sulfurtransferase with an unclear biological role

  • glpG: The rhomboid protease

  • glpR: A transcriptional repressor of genes involved in glycerol degradation

When glpG is disrupted, it has polar effects on glpR expression, which leads to hyperactivation of the glycerol degradation pathway. This hyperactivation can deplete critical intermediates such as glycerol-3-phosphate (G3P), which affects:

  • Membrane biogenesis (G3P is an important starting substrate)

  • Central metabolism (G3P is converted to dihydroxyacetone phosphate used in glycolysis/gluconeogenesis)

Fatty Acid Metabolism:

Transposon sequencing (Tn-seq) has identified glpG as important for growth in intestinal mucus, which is a major source of nutrients for bacteria in the gut. Specific effects include:

  • Impaired growth on long-chain fatty acids (LCFAs) like oleate when glpG is disrupted

  • Reduced fitness in mucus broth, which contains fatty acids as carbon sources

  • Connection to beta-oxidation pathways for fatty acid utilization

Growth ConditionWild-type F11ΔglpG Mutant
Minimal medium + G3PNo growthNo growth
Minimal medium + oleateGood growthPoor growth
Minimal medium + oleate + G3PGood growthGood growth

These findings highlight glpG's importance in coordinating glycerol metabolism with fatty acid utilization, which is crucial for bacterial survival in nutrient-limited environments such as the mammalian gut.

How can researchers effectively use solid-state NMR spectroscopy to investigate the structure and dynamics of Rhomboid protease glpG in lipid environments?

Solid-state NMR spectroscopy is a powerful technique for investigating membrane proteins like Rhomboid protease glpG in their native-like lipid environments. Here's a methodological approach for researchers:

Sample Preparation:

  • Reconstitution in Lipid Bilayers:

    • Express and purify 13C/15N-labeled glpG

    • Reconstitute in lipid bilayers that mimic bacterial membranes

    • Maintain a protein-to-lipid ratio that ensures enzymatic activity

  • Activity Verification:

    • Confirm that reconstituted glpG retains proteolytic activity using established assays

    • Compare activity in different lipid compositions to optimize conditions

Key NMR Experiments:

Experiment TypeInformation ObtainedTechnical Considerations
Proton-detected experimentsWater molecules in catalytic cavityRequires high magnetic fields and fast MAS rates
Chemical shift analysisSecondary structure elements; kinks in transmembrane helicesRequires good spectral resolution
Dynamics measurementsIdentification of dynamic hotspots (e.g., N-terminal part of TM5 and loop L4)Multiple relaxation measurements at different timescales
Relaxation dispersionConformational exchange processes (e.g., TM5 between open/closed states)CPMG or R1ρ experiments with variable pulse delays

Data Analysis and Integration:

  • Use chemical shift assignments to map secondary structure

  • Combine dynamics data with structural information to identify functionally important regions

  • Correlate observed structural features with enzymatic mechanisms

Research has demonstrated that this approach can reveal previously unidentified structural features, such as the kink in the gating helix TM5 and the dynamic hotspot at the N-terminal part of TM5 and adjacent loop L4 . These findings have significant implications for understanding substrate gating mechanisms.

What interactions does Rhomboid protease glpG have with other bacterial proteins, and how do these interactions contribute to its biological function?

While specific protein-protein interactions of Salmonella gallinarum Rhomboid protease glpG have not been extensively characterized in the provided search results, valuable insights can be drawn from studies of homologous rhomboid proteases in other bacterial species:

Known Interactions of Bacterial Rhomboid Proteases:

  • Interaction with FtsH Protease:
    In Bacillus subtilis, the rhomboid protease YqgP interacts with the membrane-bound ATP-dependent metalloprotease FtsH. This interaction was identified through affinity co-immunopurification and label-free quantitative proteomics .

  • ATPase Subunit Interactions:
    YqgP also interacts with ATPase subunits A, D, F, and G, suggesting involvement in energy-dependent processes .

Functional Significance of These Interactions:

  • Substrate Adaptor Function:
    Independent of its intrinsic protease activity, YqgP acts as a substrate adaptor for FtsH, facilitating the degradation of membrane proteins like MgtE. This dual role (protease and adaptor) unites protease and pseudoprotease functions .

  • Quality Control System:
    The YqgP-FtsH system in B. subtilis functions conceptually like a primordial form of "ER-associated degradation" (ERAD) in bacteria, suggesting an ancestral function of rhomboid-superfamily proteins .

Potential Interactions of Salmonella glpG:

Based on homology and evolutionary conservation, Salmonella gallinarum Rhomboid protease glpG may interact with:

  • Membrane-bound proteases similar to FtsH

  • Components of metabolic pathways, particularly those involved in glycerol and fatty acid metabolism

  • Transcriptional regulators (as suggested by the polar effects on glpR expression)

To investigate these interactions, researchers can employ techniques such as:

  • Co-immunoprecipitation followed by mass spectrometry

  • Bacterial two-hybrid systems

  • Crosslinking studies combined with proteomics

  • Proximity labeling approaches

Understanding these protein-protein interactions could reveal novel roles for glpG beyond its catalytic function and provide insights into how intramembrane proteases contribute to bacterial physiology and pathogenesis.

What role does Rhomboid protease glpG play in bacterial pathogenesis and host colonization?

Rhomboid protease glpG contributes significantly to bacterial pathogenesis and host colonization, particularly in the context of gut persistence and adaptation:

Role in Extraintestinal Pathogenic E. coli (ExPEC):

  • Gut Colonization:

    • glpG promotes ExPEC survival in the mammalian gut

    • This intestinal colonization is often a prerequisite for ExPEC-mediated pathogenesis

    • In a mouse gut colonization model with unperturbed natural microbiota, disruption of glpG significantly reduced ExPEC survival

  • Nutrient Acquisition:

    • glpG is important for bacterial growth in intestinal mucus, a major nutrient source in the gut

    • It contributes to fatty acid utilization pathways, allowing bacteria to exploit host-derived nutrients

Metabolic Adaptations During Infection:

Transposon sequencing (Tn-seq) screening identified multiple genes, including glpG, that contribute to ExPEC fitness in intestinal mucus. The disruption of glpG affected pathways associated with fatty acid beta-oxidation, which are critical for:

  • Energy generation during infection

  • Adaptation to nutrient-limited environments

  • Persistence in competitive gut environments

Comparison of Wild-type and ΔglpG Mutant:

ModelWild-type StrainΔglpG MutantSignificance
In vitro mucus growthNormal growthReduced fitness (CI of about -0.4 at 24h)Demonstrates role in mucus utilization
Oleate plate growthNormal growthSignificantly impairedShows importance in fatty acid metabolism
Mouse gut colonizationSuccessful colonizationSignificantly reduced survivalConfirms in vivo relevance

Unlike the related gene glpR, whose disruption affected only in vitro growth, the disruption of glpG impaired both in vitro growth and in vivo colonization, highlighting its specific role in pathogenesis .

Understanding these functions of glpG may lead to novel therapeutic strategies targeting bacterial persistence in the gut, potentially reducing the reservoir of pathogens capable of causing extraintestinal infections.

How can inhibitors of Rhomboid protease glpG be designed and tested for potential antimicrobial applications?

Designing and testing inhibitors of Rhomboid protease glpG for antimicrobial applications requires a systematic approach that leverages structural insights and functional understanding:

Inhibitor Design Strategies:

  • Structure-Based Design:

    • Utilize the known structural features of glpG, including the catalytic cavity containing water molecules and the conformational dynamics of TM5

    • Design compounds that can access the membrane-embedded active site

    • Focus on molecules that mimic the transition state of peptide bond hydrolysis

  • Peptidyl Ketoamide Scaffolds:

    • Rhomboid-specific peptidyl ketoamide inhibitors have shown efficacy at nanomolar concentrations

    • These inhibitors can be modified to enhance selectivity for bacterial rhomboid proteases

  • Rational Modifications:

    • Target the unique kink in the gating helix TM5 identified by solid-state NMR

    • Exploit the dynamic hotspot at the N-terminal part of TM5 and loop L4

Testing Methodologies:

Assay TypePurposeConsiderations
In vitro enzymatic assaysDetermine IC50/Ki valuesUse purified recombinant glpG in appropriate membrane mimetics
Cell-based assaysAssess bacterial penetration and efficacyTest against Salmonella gallinarum and related pathogens
Competition growth assaysEvaluate impact on bacterial fitnessCompare wild-type and treated bacteria in mucus or other relevant media
Mouse gut colonization modelsVerify in vivo efficacyTest ability to reduce bacterial persistence in natural microbiota settings
Cytotoxicity assaysEnsure safetyEvaluate effects on mammalian cells

Validation Experiments:

  • Mechanism Confirmation:

    • Demonstrate that inhibition of glpG affects downstream metabolic pathways similar to genetic knockout

    • Verify impaired growth on oleate media and rescue with glycerol-3-phosphate supplementation

  • Resistance Development:

    • Assess the potential for resistance development through serial passage experiments

    • Identify resistance mechanisms through whole-genome sequencing of resistant isolates

  • Specificity Testing:

    • Compare inhibition of bacterial glpG versus human rhomboid proteases

    • Evaluate effects on commensal bacteria to assess potential microbiome disruption

By targeting glpG, which is important for bacterial persistence rather than essential growth, these inhibitors might reduce pathogen colonization without imposing strong selective pressure for resistance development.

What methodological approaches should be used to identify and validate natural substrates of Rhomboid protease glpG in Salmonella?

Identifying and validating natural substrates of Rhomboid protease glpG in Salmonella requires a comprehensive multi-technique approach:

Substrate Identification Strategies:

  • Quantitative Proteomics:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) labeling combined with GeLC (Gel electrophoresis followed by Liquid Chromatography) analysis

    • Compare membrane fractions from wild-type Salmonella versus ΔglpG mutants

    • Look for peptides belonging to proteins migrating at lower-than-expected molecular weights in wild-type samples

  • Candidate Approach Based on Homology:

    • Examine substrates of rhomboid proteases in related bacteria

    • For example, in B. subtilis, YqgP cleaves the MgtE magnesium transporter

    • Test Salmonella homologs of known substrates using in vitro assays

  • Bioinformatic Prediction:

    • Analyze the Salmonella proteome for transmembrane proteins with helix-destabilizing residues

    • Search for sequence motifs associated with rhomboid recognition

    • Prioritize candidates involved in metabolic pathways associated with glpG function (glycerol and fatty acid metabolism)

Validation Methodologies:

MethodApplicationAdvantages
In vitro cleavage assaysTest direct proteolysis of candidate substratesConfirms direct enzymatic action
ImmunoblottingDetect cleavage products in vivoVerifies processing in cellular context
Site-directed mutagenesisModify putative cleavage sitesConfirms specificity of recognition
Rhomboid inhibitorsBlock processing in vivoVerifies rhomboid-dependent cleavage
Genetic complementationExpress wild-type vs. catalytically dead glpGDistinguishes between protease and non-protease functions

Functional Confirmation:

  • Phenotypic Analysis:

    • Compare phenotypes of ΔglpG mutants with knockouts of validated substrates

    • Test growth in mucus and on oleate media to link substrate processing to metabolic functions

  • Rescue Experiments:

    • Determine if expression of pre-cleaved substrate forms can rescue ΔglpG phenotypes

    • Use complementation with substrate variants resistant to glpG cleavage

Based on findings from homologous systems, potential substrate candidates in Salmonella might include:

  • Transporters (like MgtE in B. subtilis)

  • Metabolic enzymes involved in glycerol or fatty acid pathways

  • Components of secretion systems (like TatA in P. stuartii)

How can researchers effectively compare the structural and functional differences between Rhomboid protease glpG from Salmonella gallinarum and other bacterial species?

Comparing Rhomboid protease glpG across bacterial species requires systematic analysis of structural, biochemical, and functional characteristics:

Structural Comparison Approaches:

  • Sequence Analysis:

    • Conduct multiple sequence alignments of glpG from different bacterial species

    • Identify conserved catalytic residues and variable regions that might confer species-specific functions

    • Analyze the amino acid sequence of Salmonella gallinarum glpG (MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPGDPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVMVWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAGWFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT) against homologs

  • Structural Studies:

    • Compare crystal structures or NMR data of rhomboid proteases from different species

    • Focus on key features like:

      • The catalytic cavity and water molecule positioning

      • The gating helix TM5 and its conformational dynamics

      • Loop regions involved in substrate recognition

  • Homology Modeling:

    • Build structural models for species where experimental structures are unavailable

    • Use validated structures like E. coli GlpG as templates

    • Analyze predicted differences in substrate binding sites and catalytic regions

Functional Comparison Methodologies:

ApproachPurposeImplementation
Substrate specificity profilingCompare enzymatic preferencesTest activity against a panel of potential substrates
Cross-species complementationAssess functional conservationExpress glpG from different species in a ΔglpG background
Chimeric protein analysisIdentify function-specific domainsCreate fusion proteins with domains from different species
Metabolic phenotypingCompare metabolic rolesTest growth on different carbon sources across species

Case Study Comparison Table:

CharacteristicS. gallinarum glpGE. coli GlpGB. subtilis YqgP
Amino Acid Length276 residues Similar lengthSimilar length
Known SubstratesNot fully characterizedNot conclusively identifiedMgtE magnesium transporter
Associated PhenotypesUnknownGut persistence Magnesium homeostasis, protection from Mn2+/Zn2+ toxicity
Protein InteractionsUnknownUnknownFtsH protease, ATPase subunits
Metabolic RoleLikely similar to E. coliGlycerol metabolism, fatty acid utilization Regulation of magnesium transport

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.