Recombinant Salmonella gallinarum Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
arnC; SG2327; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTAACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links

KEGG: seg:SG2327

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is arnC and what biological function does it serve?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) is an enzyme that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate . This enzymatic reaction is critical for bacterial cell envelope modification, specifically in the lipid A portion of lipopolysaccharides (LPS). The modified arabinose that gets attached to lipid A plays a vital role in conferring resistance to polymyxin and other cationic antimicrobial peptides . ArnC belongs to the EC 2.4.2.53 enzyme class and is also known by several synonyms including Undecaprenyl-phosphate Ara4FN transferase and Ara4FN transferase . This enzyme represents an important component in bacterial defense mechanisms against host immune responses and certain antibiotics.

What is the significance of studying arnC in Salmonella gallinarum specifically?

Studying arnC in Salmonella gallinarum is particularly significant because S. gallinarum is a host-specific pathogen causing fowl typhoid, a severe systemic infection in poultry . This disease leads to substantial economic losses in many developing countries due to high morbidity and mortality rates . Understanding the role of arnC in S. gallinarum can provide insights into the pathogen's survival mechanisms during infection. The enzyme's function in modifying bacterial cell surface components likely contributes to the virulence and persistence of S. gallinarum in host tissues. Recent studies have shown that modifications to related genes in S. gallinarum significantly impact pathogenicity and immune response in chicken models, suggesting that arnC may play a similar role in pathogenesis . This makes arnC an attractive target for both fundamental research and potential therapeutic interventions.

How does arnC contribute to antimicrobial resistance in bacteria?

ArnC contributes to antimicrobial resistance primarily through its role in modifying lipid A structure, which alters the bacterial cell surface charge and reduces the binding affinity of cationic antimicrobial peptides . By catalyzing the transfer of 4-deoxy-4-formamido-L-arabinose to undecaprenyl phosphate, arnC facilitates a critical step in the process that ultimately results in the addition of positively charged moieties to lipid A . This modification reduces the negative charge of the bacterial outer membrane, thereby decreasing the electrostatic attraction between the membrane and cationic antimicrobial compounds like polymyxins . Recent proteomics studies have shown that arnC expression levels change in response to antibiotic exposure, suggesting its dynamic role in adaptive resistance mechanisms . In particular, the fold change of arnC expression (0.60 to 2.50) observed in antibiotic-resistant strains indicates its importance in responding to antimicrobial challenges . This resistance mechanism is particularly relevant for understanding how pathogens like S. gallinarum evade both host immunity and therapeutic interventions.

What methodological approaches are most effective for studying arnC enzyme kinetics?

For studying arnC enzyme kinetics, researchers should employ a multi-faceted approach combining recombinant protein expression, purification, and advanced enzymatic assays. Begin with heterologous expression of the recombinant arnC from S. gallinarum in an E. coli expression system using a vector containing a histidine tag for purification purposes . Optimize expression conditions including temperature (typically 18-25°C for membrane-associated enzymes), IPTG concentration (0.1-1.0 mM), and induction time (4-16 hours). For purification, employ immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain highly pure enzyme preparations. For kinetic studies, utilize radioisotope-labeled UDP-4-deoxy-4-formamido-L-arabinose as substrate and develop a scintillation proximity assay or thin-layer chromatography to monitor product formation. Measure initial reaction velocities across varying substrate concentrations (1-10x Km range) to determine key kinetic parameters including Km, Vmax, and kcat. Additionally, employ isothermal titration calorimetry (ITC) to characterize substrate binding properties and thermodynamic parameters of the enzymatic reaction. These approaches collectively provide a comprehensive kinetic profile of arnC activity essential for understanding its catalytic mechanism and potential inhibition strategies.

What structural characteristics of arnC determine its substrate specificity and catalytic efficiency?

The structural characteristics determining arnC's substrate specificity and catalytic efficiency remain incompletely characterized but likely involve specific domains conserved across glycosyltransferase enzymes. Based on homology with related transferases, the enzyme likely contains a nucleotide-binding domain that recognizes the UDP moiety of UDP-4-deoxy-4-formamido-L-arabinose with high specificity . Critical catalytic residues presumably include conserved aspartate or glutamate residues that coordinate divalent metal ions (typically Mg²⁺ or Mn²⁺) essential for nucleotide binding and catalysis. The enzyme likely adopts a GT-B fold characteristic of glycosyltransferases, consisting of two Rossmann-like domains with a catalytic site at their interface. To definitively characterize these structural features, researchers should pursue X-ray crystallography or cryo-electron microscopy studies of purified recombinant arnC in complex with substrate analogs or product mimics. Site-directed mutagenesis of predicted catalytic residues followed by activity assays would confirm their functional importance. Additionally, molecular dynamics simulations could provide insights into the conformational changes occurring during catalysis. Understanding these structural determinants would facilitate rational design of specific inhibitors targeting this enzyme as potential antimicrobial agents against S. gallinarum infections.

How do genetic variations in arnC across different Salmonella serovars correlate with virulence and host specificity?

Genetic variations in arnC across different Salmonella serovars likely contribute significantly to virulence patterns and host specificity. While S. gallinarum demonstrates strict host specificity causing systemic infection in poultry , other serovars exhibit broader host ranges with varying disease presentations. Comparative genomic analysis would reveal sequence variations in arnC that may correlate with these phenotypic differences. Researchers should sequence and analyze the arnC gene and its regulatory regions from multiple Salmonella serovars, particularly comparing host-restricted variants (like S. gallinarum and S. Typhi) with broad-host-range serovars (like S. Typhimurium). Attention should focus on non-synonymous substitutions that might alter enzyme activity or substrate specificity. Further investigation should employ allelic exchange experiments, replacing the native arnC in various serovars with variants from other serovars to assess the impact on host colonization and virulence in appropriate animal models. High-throughput approaches such as transposon-sequencing (Tn-seq) under different selective pressures could identify genetic interactions that modulate arnC function in different hosts. The integration of these data with structural information would provide a comprehensive understanding of how evolutionary changes in arnC contribute to Salmonella's adaptation to different host environments and virulence capabilities.

What are the optimal conditions for expressing and purifying recombinant arnC protein for enzymatic studies?

The optimal conditions for expressing and purifying recombinant Salmonella gallinarum arnC involve careful consideration of expression systems, growth conditions, and purification strategies. For efficient expression, the BL21(DE3) E. coli strain containing the pET expression system has demonstrated superior results for membrane-associated enzymes like arnC . Clone the arnC gene with optimized codon usage into a vector containing an N-terminal His6-tag to facilitate purification while minimizing interference with the C-terminal catalytic domain. Culture cells at 37°C until reaching an OD600 of 0.6-0.8, then reduce the temperature to 18°C before induction with 0.5 mM IPTG for 16-18 hours. This temperature shift minimizes inclusion body formation for membrane-associated proteins. For cell lysis, employ a combination of lysozyme treatment (100 μg/ml, 30 minutes on ice) followed by sonication in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and 1 mM DTT. Include detergents such as 0.5% n-dodecyl-β-D-maltoside (DDM) to solubilize membrane-associated proteins effectively. For purification, use nickel affinity chromatography with a gradual imidazole gradient (20-250 mM) to minimize non-specific binding, followed by size exclusion chromatography to achieve >95% purity. The final buffer should contain 25 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, 0.05% DDM, and 1 mM DTT to maintain protein stability. These optimized conditions consistently yield 3-5 mg of pure, active enzyme per liter of bacterial culture suitable for enzymatic and structural studies.

How can researchers effectively measure arnC enzymatic activity in vitro and in vivo?

Effectively measuring arnC enzymatic activity requires distinct approaches for in vitro and in vivo settings. For in vitro assays, develop a coupled spectrophotometric assay that monitors the release of UDP during the transfer reaction . This can be achieved by coupling UDP release to NADH oxidation via pyruvate kinase and lactate dehydrogenase, enabling continuous monitoring at 340 nm. Alternatively, implement a radiometric assay using [¹⁴C]-labeled UDP-4-deoxy-4-formamido-L-arabinose as substrate and measure product formation via scintillation counting after separation by thin-layer chromatography. The reaction buffer should contain 50 mM HEPES pH 7.5, 10 mM MgCl₂, 100 mM NaCl, and 0.05% DDM, with temperature maintained at 30°C for optimal enzyme activity.

For in vivo activity assessment, develop a reporter system where arnC expression is linked to a fluorescent protein, allowing real-time monitoring of expression levels in response to various stimuli such as antibiotic exposure. Complement this with mass spectrometry-based lipidomics to quantify the modified lipid A species containing 4-deoxy-4-formamido-L-arabinose. Additionally, implement polymyxin survival assays comparing wild-type bacteria with arnC knockout mutants, as reduced survival in the mutants directly correlates with decreased enzymatic activity in vivo . For more precise quantification, develop an LC-MS/MS method to directly measure the levels of modified lipid A species in bacterial membranes extracted from cells grown under different conditions. This comprehensive approach provides a clear picture of arnC function in both isolated systems and within the complex cellular environment.

What experimental design best evaluates the role of arnC in antimicrobial resistance development?

The optimal experimental design for evaluating arnC's role in antimicrobial resistance development incorporates multiple complementary approaches. Begin with creating a precise arnC deletion mutant in S. gallinarum using CRISPR-Cas9 genome editing, alongside a complemented strain expressing arnC from a plasmid under native promoter control . Subject these strains, along with the wild-type, to minimum inhibitory concentration (MIC) determinations for polymyxins and other cationic antimicrobial peptides using standardized broth microdilution methods. Conduct time-kill kinetics assays exposing all strains to sub-MIC and MIC levels of antimicrobials, with viable counting at multiple timepoints (0, 2, 4, 8, 12, 24 hours).

For in-depth analysis, implement experimental evolution by serially passaging all strains in gradually increasing concentrations of polymyxin B for 20-30 passages, followed by whole-genome sequencing to identify compensatory mutations that arise in the absence of arnC. Complement these approaches with transcriptomics and proteomics analyses comparing gene/protein expression profiles between wild-type and arnC mutant strains under antimicrobial stress . Include the protein fold change data (shown in Table 1 below, adapted from search result ) to identify networks of genes responding to arnC deletion.

Table 1: Protein Expression Changes in Response to Antibiotic Resistance Development

ProteinDescriptionFold change in resistant strainFold change after regulatory gene disruptionP value
ArnCPutative undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase0.602.500.046
SmeYPutative secretion protein-HlyD family3.46<0.050.009
SmeZEfflux pump membrane transporter9.760.350.000
MacBMacrolide export ATP-binding/permease protein>20<0.05<0.005

Finally, perform in vivo infection studies in a chicken model comparing the virulence and tissue persistence of wild-type and arnC mutant strains under antimicrobial treatment regimens . This comprehensive design enables assessment of arnC's direct biochemical role in resistance, its position in regulatory networks, evolutionary adaptations to its absence, and ultimate impact on in vivo pathogenesis under antimicrobial pressure.

What techniques can be used to study the interaction between arnC and other components of the LPS modification pathway?

To study interactions between arnC and other components of the LPS modification pathway, researchers should employ a multi-technique approach focusing on protein-protein interactions and pathway integration. Begin with bacterial two-hybrid assays screening arnC against other proteins in the arn operon (arnA, arnB, arnD, arnE, arnF, and arnT) to identify direct binding partners. Follow with co-immunoprecipitation experiments using antibodies against tagged versions of arnC to pull down interaction partners, coupled with mass spectrometry identification. For in vivo validation, implement fluorescence resonance energy transfer (FRET) by tagging arnC and candidate partners with appropriate fluorophore pairs (e.g., CFP/YFP) and measuring energy transfer efficiency in live cells.

To understand the functional integration of arnC within the pathway, conduct metabolic flux analysis using isotope-labeled precursors and trace their incorporation into final LPS products. This should be complemented by creating a series of single and double gene knockouts within the arn operon to identify synthetic lethal or synthetic sick combinations with arnC, revealing functional relationships. Additionally, implement protein cross-linking experiments using membrane-permeable crosslinkers followed by mass spectrometry to capture transient interactions that might occur during LPS modification.

For structural studies of protein complexes, employ cryo-electron microscopy of membrane fractions enriched in arnC and its partners, potentially revealing the spatial organization of the enzymatic machinery. Combined with super-resolution microscopy using fluorescently tagged proteins, this approach can map the subcellular localization and potential co-localization of pathway components. These complementary techniques will provide a comprehensive understanding of how arnC functionally integrates with other enzymes to coordinate LPS modification and antimicrobial resistance.

How might targeting arnC function contribute to novel antimicrobial development strategies?

Targeting arnC function represents a promising strategy for novel antimicrobial development due to its critical role in antimicrobial peptide resistance . Inhibiting arnC would prevent the modification of lipid A with 4-deoxy-4-formamido-L-arabinose, thereby increasing bacterial susceptibility to polymyxins and host defense peptides . This approach could potentially restore the efficacy of existing antibiotics against resistant strains by chemically disarming a key bacterial defense mechanism. Several strategies could be employed for developing arnC inhibitors. Structure-based drug design using crystallographic data or homology models could identify molecules that competitively bind to the enzyme's active site or allosterically modify its conformation. Natural product screening, particularly focusing on compounds from soil microorganisms that compete with Salmonella in environmental niches, might reveal evolved inhibitors. Peptide-based inhibitors designed to mimic substrate or product structures represent another viable approach.

The most promising application would be developing arnC inhibitors as adjuvants to be co-administered with polymyxins or other cationic antimicrobials, creating a combination therapy that blocks resistance mechanisms while delivering the killing blow. Researchers should also explore species-specificity of inhibitors targeting unique structural features of S. gallinarum arnC to develop narrow-spectrum agents for veterinary applications . The development pipeline should include enzymatic assays, bacterial susceptibility testing, and ultimately animal infection models to validate efficacy. Since arnC appears to be most critical during infection processes rather than normal growth, this target might offer the advantage of reduced selection pressure for resistance development compared to traditional antibiotics targeting essential functions.

How do environmental factors influence arnC expression and activity in bacterial populations?

Environmental factors significantly influence arnC expression and activity through complex regulatory networks that sense and respond to changing conditions. pH appears to be a critical factor, with acidic environments (pH 5.5-6.5) typically upregulating arnC expression as part of the bacterial acid stress response. This is particularly relevant in the context of host environments such as the macrophage phagosome where Salmonella encounters acidic conditions . Magnesium limitation is another key trigger, activating the PhoPQ two-component system which subsequently upregulates arnC and other genes involved in LPS modification. This response occurs in magnesium-restricted environments including those within host tissues during infection.

Temperature fluctuations also modulate arnC expression, with increased activity observed at physiological host temperatures (37-42°C for poultry) compared to environmental temperatures, suggesting temperature-responsive regulatory elements in the promoter region. The presence of antimicrobial peptides themselves appears to trigger a feed-forward regulatory loop that increases arnC expression, as evidenced by proteomics data showing altered expression patterns in response to antibiotic exposure .

The bacterial growth phase also affects arnC activity, with expression typically peaking during late logarithmic phase as cells prepare for potential stress conditions. Oxygen availability represents another modulating factor, with microaerobic conditions similar to those in intestinal environments potentially enhancing expression. These environmental responses are coordinated through complex regulatory networks involving two-component systems like PhoPQ and PmrAB, which integrate multiple environmental signals to fine-tune arnC expression according to the specific challenges faced by the bacterial population in different host and environmental niches .

What are the evolutionary implications of arnC conservation across bacterial species?

The conservation of arnC across bacterial species has profound evolutionary implications, reflecting its crucial role in bacterial adaptation and survival. Phylogenetic analysis reveals that arnC homologs are widely distributed among Gram-negative bacteria, particularly in Enterobacteriaceae, suggesting an ancient origin predating the divergence of these bacterial lineages. This conservation indicates strong selective pressure to maintain arnC function for antimicrobial peptide resistance . Interestingly, while the core catalytic domain shows high conservation, the regulatory regions of arnC exhibit greater variability, suggesting species-specific adaptation of expression patterns to different ecological niches and host environments.

In host-restricted pathogens like S. gallinarum, arnC likely played a crucial role during the evolutionary specialization process, facilitating adaptation to the specific antimicrobial defenses of avian hosts . The enzyme represents an excellent example of the evolutionary arms race between hosts and pathogens, where bacterial LPS modification systems evolved to counter host antimicrobial peptides, which in turn evolved greater diversity and potency. From a broader perspective, arnC conservation highlights how fundamental biochemical mechanisms of antimicrobial resistance predated human antibiotic use, explaining the rapid emergence of resistance to polymyxins and similar compounds.

Comparative genomics also reveals interesting patterns in copy number and gene arrangement, with some bacterial species harboring multiple arnC paralogs potentially providing functional redundancy or specialization. Additionally, horizontal gene transfer appears to have contributed to arnC distribution in some lineages, particularly in environmental bacteria that may serve as reservoirs for resistance determinants. This evolutionary history underscores the challenges in developing sustainable antimicrobial strategies and emphasizes the importance of understanding evolutionary processes in predicting and countering resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.