Recombinant Salmonella gallinarum UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Salmonella gallinarum UPF0208 membrane protein YfbV (yfbV) is a protein associated with Salmonella gallinarum, a bacterium that causes fowl typhoid in chickens . YfbV is also referred to by the synonyms yfbV, SG2365, and UPF0208 membrane protein YfbV.

Characteristics

YfbV is a membrane protein, specifically located in the cell's inner membrane as a multi-pass membrane protein. It belongs to the UPF0208 protein family. The protein sequence consists of 151 amino acids .

Production and Availability

  • Recombinant Production Recombinant YfbV is produced using various expression systems, including yeast, E. coli, baculovirus, and mammalian cells. The tag type is determined during the manufacturing process.

  • Purity Recombinant YfbV typically has a purity level greater than 85% as determined by SDS-PAGE.

  • Storage It is recommended to store the protein at -20°C, with long-term storage at -20°C or -80°C advised . Repeated freezing and thawing cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

  • Buffer Before lyophilization, the protein is usually in a Tris/PBS-based buffer with 6% Trehalose.

Research Applications

Salmonella gallinarum outer membrane proteins (OMPs), including YfbV, have been investigated for their potential as vaccine candidates . Membrane proteins from S. gallinarum may provide better protection compared to formalin-killed whole-cell bacterin .

  • ELISA Recombinant Salmonella gallinarum UPF0208 membrane protein YfbV (yfbV) can be used in ELISA assays .

  • Immunoproteomics Employed in immunoproteomic studies to identify antigenic cross-reactive proteins among different Salmonella serovars .

  • Vaccine Development Explored as a potential component in subunit vaccines against Salmonella infections .

Proteomic Map and Database

A proteomic map of antigenic SG-OMPs was created by two-dimensional electrophoresis (2DE), which detected a total of 174 spots .

Identification of Antigen-Reactive Spots

Using PMF, twenty-two antigen-reactive spots were identified as nine specific proteins . OmpA (outer membrane protein A) was found to be the most abundant protein, exhibiting seven protein species .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; SG2365; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: seg:SG2365

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YfbV protein and where is it located in Salmonella gallinarum?

YfbV is a UPF0208 membrane protein found in Salmonella gallinarum (strain 287/91 / NCTC 13346). It is primarily located in the inner membrane of the bacterial cell. The protein belongs to the PF04217 protein family and shares structural similarities with YfbV proteins found in other Enterobacteriaceae species, including Escherichia coli . The protein consists of 151 amino acids and is encoded by the yfbV gene, which spans 456 base pairs in the bacterial genome .

How does YfbV protein from Salmonella gallinarum compare to YfbV proteins in other Salmonella species?

YfbV proteins show high conservation across different Salmonella species. When comparing the amino acid sequences of YfbV from Salmonella gallinarum (strain 287/91 / NCTC 13346) and Salmonella typhi, there is only one notable difference: at position 84, Salmonella gallinarum has a valine (V) in the sequence "SVTPLPP" while Salmonella typhi has a leucine (L) in the sequence "SLTPLPP" . This high degree of conservation suggests an important functional role for this protein across Salmonella species.

What are the optimal conditions for expression and purification of recombinant Salmonella gallinarum YfbV?

Based on standard protocols for similar membrane proteins:

  • Expression systems: The protein can be expressed in E. coli, yeast, baculovirus, or mammalian cell expression systems . E. coli expression systems are most commonly used due to their high yield and relatively low cost.

  • Purification method:

    • Use a Tris-based buffer with 50% glycerol for optimal protein stability

    • Include appropriate detergents for membrane protein solubilization

    • Utilize affinity chromatography with a tag determined during the production process

    • Perform size exclusion chromatography to enhance purity

  • Storage conditions: Store at -20°C for short-term storage, and -80°C for extended storage. Avoid repeated freezing and thawing cycles that can compromise protein integrity. Working aliquots can be stored at 4°C for up to one week .

How can I assess the structural integrity and functional activity of purified YfbV protein?

Multiple complementary approaches should be employed:

  • Structural integrity assessment:

    • SDS-PAGE to verify molecular weight and purity

    • Circular dichroism (CD) to evaluate secondary structure

    • Limited proteolysis to assess proper folding

    • Mass spectrometry for accurate mass determination

  • Functional activity:

    • Although the exact function of YfbV remains under investigation, its role in chromosome structure regulation (as observed in E. coli homologs) suggests examining DNA-binding properties

    • Membrane incorporation assays to confirm proper insertion into lipid bilayers

    • Protein-protein interaction studies to identify binding partners

  • Immunological activity assessment:

    • Hemagglutination assays (similar to those used for analyzing fimbriae expression in Salmonella strains)

    • Antigen-antibody agglutination tests using specific antisera

What are the recommended approaches for generating antibodies against Salmonella gallinarum YfbV?

For generating high-quality antibodies against YfbV:

  • Antigen preparation:

    • Use purified recombinant YfbV protein with >90% purity

    • Alternatively, use synthetic peptides from highly immunogenic epitopes, particularly from exposed regions of the protein

  • Immunization protocol:

    • For polyclonal antibodies: Immunize rabbits with 400 μg protein/100g body weight with a mineral-oil adjuvant for optimal response

    • Multiple boosters at 2-3 week intervals to enhance antibody titers

  • Antibody purification:

    • Affinity purification using immobilized YfbV protein

    • ELISA testing to confirm specificity and determine optimal working dilutions

  • Validation:

    • Western blotting against both recombinant protein and native protein from bacterial lysates

    • Immunoprecipitation to confirm recognition of native protein

    • Cross-reactivity testing against YfbV from other Salmonella species

What is the current understanding of YfbV protein's function in Salmonella gallinarum?

The precise function of YfbV in Salmonella gallinarum remains under investigation, but several roles have been suggested:

  • Chromosome structure regulation: Based on E. coli YfbV homolog annotations, it may play a role in regulating chromosome structure .

  • Membrane integrity: As a membrane protein, it likely contributes to membrane structure and possibly permeability.

  • Potential pathogenicity factor: The protein's conservation across Salmonella species suggests it may have a role in bacterial survival or virulence, particularly since other membrane proteins from S. gallinarum have been shown to elicit protective immune responses against fowl typhoid .

  • Possible role in systemic infection: While not directly demonstrated for YfbV, other membrane proteins in S. gallinarum are implicated in systemic infection processes based on studies of deletion mutants, suggesting YfbV might have similar functions .

Further research is needed to definitively characterize its function, particularly through knockout studies and complementation experiments.

How can YfbV be utilized in vaccine development against fowl typhoid?

YfbV has potential as a component in vaccine development strategies:

  • As a recombinant subunit vaccine:

    • Purified YfbV protein can be formulated with appropriate adjuvants

    • Studies with other S. gallinarum membrane proteins have shown that when administered at 400 μg/100g of live body weight with an oil adjuvant, they provided 100% protection against oral challenge

  • As part of a vectored vaccine:

    • YfbV can be expressed in attenuated Salmonella vector strains

    • Such approaches with other proteins have shown success in inducing both humoral and cell-mediated immunity

  • For cross-protection strategies:

    • The high conservation of YfbV across Salmonella species suggests potential for cross-protection

    • Similar approaches using the OmpA protein have demonstrated cross-reactivity among Salmonella Enteritidis, Salmonella Typhimurium, and Salmonella Gallinarum

  • Delivery considerations:

    • Expression on the bacterial surface generally induces stronger immune responses than periplasmic expression

    • Combination with other antigens may enhance protective efficacy

What experimental models are appropriate for testing YfbV-based vaccines against Salmonella gallinarum?

Based on established protocols for Salmonella gallinarum vaccine testing:

  • In vitro assays:

    • Antigen-antibody agglutination tests

    • Serum bactericidal assays

    • Cell culture infection models using chicken macrophages or epithelial cells

  • In vivo models:

    • Chicken oral infection model: Oral inoculation with 10^8 CFU followed by monitoring for:

      • Clinical signs and mortality

      • Bacterial loads in liver and spleen at 1, 3, 5, and 7 days post-infection

      • Histopathological examinations of liver and spleen

      • Pro-inflammatory cytokine expression (IL-1β, TNF-α, CXCLi1)

  • Challenge studies:

    • Vaccinated chickens should be challenged with virulent wild-type S. gallinarum

    • Protection is assessed by survival rates and reduction in bacterial colonization of organs

    • Long-term protection can be evaluated up to 45 days post-vaccination

  • Immune response evaluation:

    • Antibody titers measured by ELISA

    • Cell-mediated immunity assessment through lymphocyte proliferation assays

    • Cytokine profiling to characterize Th1/Th2 balance

How does YfbV function compare between pathogenic and non-pathogenic Salmonella strains?

This comparative analysis requires sophisticated approaches:

  • Sequence and structural analysis:

    • Multiple sequence alignment of YfbV from diverse Salmonella strains

    • Structural modeling to identify conserved domains and variant regions

    • Phylogenetic analysis to correlate sequence variations with pathogenicity

  • Expression profiling:

    • Quantitative RT-PCR to measure yfbV expression levels under various conditions

    • RNA-seq analysis to determine if yfbV is differentially expressed in pathogenic vs. non-pathogenic strains

    • Protein expression analysis using Western blotting with anti-YfbV antibodies

  • Functional comparison:

    • Construction of isogenic mutants in different Salmonella backgrounds

    • Complementation studies to assess functional conservation

    • Heterologous expression to determine if YfbV from pathogenic strains confers any advantage when expressed in non-pathogenic backgrounds

  • Host interaction studies:

    • Adhesion and invasion assays using host cells

    • Immunomodulation effects of YfbV variants

    • Persistence in macrophages and other immune cells

What are the challenges in distinguishing the immunological responses to YfbV from those to other Salmonella membrane proteins?

Several sophisticated approaches can address this challenge:

  • Epitope mapping:

    • Identify YfbV-specific epitopes using peptide arrays

    • Develop monoclonal antibodies against unique YfbV epitopes

    • Use epitope-specific antibodies for selective detection

  • Competitive binding assays:

    • Pre-absorption of sera with other purified membrane proteins

    • Competitive ELISA to measure specific binding to YfbV

    • Surface plasmon resonance to quantify binding affinities

  • Knockout/complementation strategies:

    • Compare immune responses to wild-type strains versus yfbV deletion mutants

    • Restore responses through complementation with the yfbV gene

  • Cross-reactivity assessment:

    • Two-dimensional immunoblotting as used for OmpA studies

    • Testing against multiple Salmonella serovars to identify cross-reactive epitopes

    • Absorption studies to remove cross-reactive antibodies

What are common challenges in expressing and purifying recombinant YfbV and how can they be addressed?

ChallengePossible CausesSolutions
Low expression yieldToxicity to host cells, codon biasUse tightly regulated expression systems, codon optimization, lower induction temperature (16-20°C)
Protein insolubilityMembrane protein hydrophobicityTry different detergents (DDM, LDAO, CHAPS), use fusion tags (MBP, SUMO), optimize solubilization conditions
Protein degradationProtease activity, instabilityAdd protease inhibitors, reduce expression time, include glycerol (50%) in buffers
Poor purityNon-specific binding to purification matrixOptimize washing conditions, use two-step purification, include low concentrations of detergent in all buffers
Loss of function after purificationDenaturation, incorrect foldingAvoid repeated freeze-thaw cycles, store working aliquots at 4°C for up to one week , use lipid reconstitution

How can I adapt methods from adaptive laboratory evolution studies to improve YfbV expression or stability?

Based on adaptive laboratory evolution (ALE) approaches used for Salmonella:

  • Sequential passaging strategy:

    • Design experimental lineages (EL) with increasing selection pressure

    • Use sub-minimum inhibitory concentrations (sub-MIC) of stressors initially

    • Calculate the number of bacterial generations using the equation n = ln(N/N₀)/ln(2), where N is the final number of cells and N₀ is the initial number

  • Selection conditions:

    • Expression toxicity: Gradually increase induction levels

    • Temperature stress: Incrementally adjust growth temperatures

    • Detergent tolerance: Gradually increase detergent concentrations for membrane protein expression

  • Evaluation methods:

    • Quantify protein yield after each passage

    • Assess protein stability using limited proteolysis

    • Monitor growth rates by measuring OD₆₀₀

    • Verify genetic changes through whole genome sequencing

  • Leveraging evolved strains:

    • Identify beneficial mutations that improve YfbV expression

    • Generate stable production strains carrying these mutations

    • Apply findings to expression of other membrane proteins

What strategies can address the cross-reactivity issues when developing immunological assays for YfbV detection?

Cross-reactivity presents significant challenges for specific YfbV detection:

  • Epitope-focused approaches:

    • Identify unique peptide regions specific to YfbV

    • Develop antibodies against these unique epitopes

    • Use competitive assays with purified YfbV to confirm specificity

  • Advanced purification techniques:

    • Implement two-dimensional gel electrophoresis to separate YfbV from other proteins

    • Employ immunoaffinity chromatography with highly specific antibodies

    • Use size exclusion chromatography as a final polishing step

  • Validation strategies:

    • Test against yfbV knockout strains as negative controls

    • Perform pre-absorption with related proteins to remove cross-reactive antibodies

    • Validate with mass spectrometry confirmation of detected proteins

  • Multiplexed detection systems:

    • Develop multiplex assays that can simultaneously identify and distinguish YfbV from other membrane proteins

    • Include internal controls to verify assay specificity

    • Use machine learning algorithms to analyze complex antibody binding patterns

What genomic and proteomic approaches could further elucidate YfbV function in Salmonella pathogenesis?

Advanced multi-omics approaches can reveal YfbV's role:

  • Transcriptomic analysis:

    • RNA-seq to identify genes co-regulated with yfbV

    • Analysis of yfbV expression under different infection-relevant conditions

    • Comparison between wild-type and yfbV mutant transcriptomes

  • Proteomic approaches:

    • Proximity-dependent biotin identification (BioID) to identify protein interaction partners

    • Quantitative proteomics to detect changes in membrane proteome composition in yfbV mutants

    • Phosphoproteomics to identify signaling pathways affected by YfbV

  • Structural genomics:

    • Cryo-EM structure determination of YfbV in membrane context

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Systems biology integration:

    • Multi-omics data integration to place YfbV in relevant pathways

    • Network analysis to identify functional modules affected by YfbV

    • Predictive modeling of YfbV's impact on bacterial fitness

How might YfbV contribute to the development of novel vaccine strategies beyond fowl typhoid?

YfbV's potential extends beyond conventional vaccine approaches:

  • Cross-species protection:

    • Evaluate YfbV-based vaccines against multiple Salmonella serovars

    • Assess protection against both poultry-specific and zoonotic serovars

    • Combine with other conserved antigens for broader protection

  • Advanced delivery platforms:

    • Incorporate YfbV into outer membrane vesicles (OMVs)

    • Develop nanoparticle formulations for enhanced stability and delivery

    • Explore mucosal delivery systems for targeted immunity

  • Genetic vaccine approaches:

    • Design DNA vaccines encoding optimized YfbV sequences

    • Develop mRNA vaccines for transient expression

    • Create viral vector vaccines expressing YfbV

  • Combination strategies:

    • Identify synergistic antigen combinations including YfbV

    • Explore prime-boost strategies using different YfbV delivery systems

    • Develop polyvalent vaccines targeting multiple life stages or serotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.