Recombinant Salmonella gallinarum UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; SG1432; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYAHLVQLVLDAQARREISRFAAESTLMIAVSSLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links

KEGG: seg:SG1432

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is the ycjF gene across Salmonella species and related bacteria?

The ycjF gene shows significant conservation across Salmonella species and related Enterobacteriaceae. Comparative analysis reveals high sequence similarity between Salmonella gallinarum ycjF and homologs in Escherichia coli. For instance, the UPF0283 membrane protein ycjF in E. coli O6 (UniProt NO.: P0A8R8) and E. coli O7:K1 (UniProt NO.: B7NHM5) share substantial sequence homology with the Salmonella gallinarum protein .

Key differences are observed primarily in the N-terminal region, with the E. coli sequence beginning with "MTEPLKPRIDFDGPLE" compared to Salmonella gallinarum's "MSEPLKPRIDFAEPL" . This high conservation suggests that ycjF likely plays an important functional role in bacterial physiology that has been preserved through evolution.

What is currently known about the function of ycjF protein?

Despite being classified as a membrane protein, the specific function of ycjF remains largely unknown, as indicated by its UPF (Uncharacterized Protein Family) designation. Current research suggests it may be involved in:

  • Membrane integrity or transport functions based on its predicted topology

  • Potential role in bacterial stress response

  • Possible involvement in bacterial pathogenesis

What are the optimal expression systems for producing recombinant Salmonella gallinarum ycjF protein?

The most widely used expression system for recombinant Salmonella gallinarum ycjF is E. coli, as evidenced by multiple commercial sources and research protocols . Specific methodological considerations include:

Expression SystemAdvantagesConsiderations
E. coli- High yield
- Well-established protocols
- Cost-effective
- May require optimization for membrane protein expression
- Potential folding issues with transmembrane domains
Yeast- Better for eukaryotic studies
- Improved folding of complex proteins
- Lower yield than E. coli
- More complex media requirements
Baculovirus- Superior for large or complex proteins
- Better post-translational modifications
- More expensive
- Longer production timeline

For most research applications, E. coli expression using a T7 promoter system (such as pET vectors) with an N-terminal His-tag appears to be the standard approach for recombinant ycjF production .

What purification strategies yield the highest purity and biological activity of recombinant ycjF protein?

Based on available protocols for recombinant ycjF protein, the following purification strategy is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Intermediate Purification: Ion exchange chromatography to remove charged contaminants

  • Polishing Step: Size exclusion chromatography for final purity

For membrane proteins like ycjF, the following considerations are critical:

  • Detergent Selection: Use mild detergents (e.g., n-dodecyl-β-D-maltoside) during extraction and purification to maintain native conformation

  • Buffer Optimization: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been successfully used for storage

  • Glycerol Addition: Addition of 5-50% glycerol (final concentration) helps maintain stability during storage at -20°C/-80°C

Critical Quality Control Steps:

  • SDS-PAGE analysis (>90% purity expected)

  • Western blot confirmation

  • Mass spectrometry verification of intact protein

How should researchers store and handle recombinant ycjF protein to maintain stability and activity?

Proper storage and handling of recombinant ycjF protein is essential to preserve its structural integrity and functional activity:

Short-term Storage:

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which can cause protein degradation

Long-term Storage:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to prevent freeze-thaw cycles

  • Add 5-50% glycerol as a cryoprotectant (50% is generally recommended)

Reconstitution Protocol:

  • Briefly centrifuge vial prior to opening to bring contents to bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to final concentration of 50%

  • Prepare small aliquots to minimize freeze-thaw cycles

Following these guidelines will help ensure the recombinant protein maintains its structural and functional properties throughout the research process.

How can recombinant ycjF protein be used in Salmonella gallinarum pathogenesis studies?

Recombinant ycjF protein can be a valuable tool in Salmonella gallinarum pathogenesis studies through multiple experimental approaches:

  • Infection Model Studies:

    • Use purified recombinant ycjF to investigate host-pathogen interactions

    • Study potential immunomodulatory effects in chicken cell culture systems

    • Compare wild-type and ycjF-deficient strains in chicken infection models

  • Vaccination Strategies:

    • Evaluate recombinant ycjF as a potential subunit vaccine candidate against fowl typhoid

    • Test immunogenicity in combination with appropriate adjuvants

    • Measure protective efficacy against challenge with virulent Salmonella gallinarum

  • Molecular Interaction Studies:

    • Identify host cell receptors or targets that interact with ycjF

    • Investigate signaling pathways affected by ycjF expression

    • Map functional domains through site-directed mutagenesis

Research has demonstrated that Salmonella gallinarum causes fowl typhoid, a septicemic disease with significant economic impact on the poultry industry, particularly in developing countries . Understanding the role of membrane proteins like ycjF may provide new insights into pathogenesis mechanisms.

What approaches can be used to study the function of Salmonella gallinarum ycjF protein?

Several complementary approaches can be employed to elucidate the function of ycjF:

  • Gene Knockout Studies:

    • Create a ycjF deletion mutant using λ-Red recombination system

    • Assess phenotypic changes in growth, stress resistance, and virulence

    • Perform complementation studies to confirm phenotype specificity

  • Transcriptomic and Proteomic Analysis:

    • Compare gene expression profiles between wild-type and ycjF mutant strains

    • Identify proteins with altered expression in response to ycjF deletion

    • Map potential regulatory networks involving ycjF

  • Structural Biology Approaches:

    • Determine the three-dimensional structure using X-ray crystallography or cryo-EM

    • Identify potential binding pockets or functional domains

    • Generate structure-based hypotheses for functional testing

  • Comparative Genomics:

    • Analyze conservation patterns of ycjF across bacterial species

    • Identify co-evolved genes that may function with ycjF

    • Examine genomic context for functional clues

Recent studies on Salmonella gallinarum have successfully used similar approaches to characterize other genes, such as purB, where targeted deletion was performed to evaluate its role in virulence . Similar methodologies could be applied to study ycjF function.

How does ycjF protein potentially contribute to Salmonella gallinarum virulence?

While the specific role of ycjF in virulence has not been fully characterized, several mechanisms can be hypothesized based on its membrane localization and conservation:

  • Potential Contributions to Virulence:

    • Membrane integrity maintenance during host colonization

    • Possible role in nutrient acquisition during infection

    • Contribution to stress resistance within host environments

    • Potential involvement in host immune evasion strategies

  • Comparison with Known Virulence Factors:
    Unlike well-characterized virulence genes like invA (invasion gene) and spvC (Salmonella plasmid virulence), which have established roles in pathogenesis , ycjF's contribution remains speculative. Research has shown that Salmonella gallinarum causes fowl typhoid through systemic invasion that can result in high mortality in poultry flocks .

  • Experimental Evidence from Related Systems:
    Studies on other membrane proteins in Salmonella have demonstrated their importance in adaptation to the host environment. For example, research on flagellar proteins has shown they modulate chicken immune response, affecting bacterial clearance and infection severity . Similar mechanisms might apply to ycjF.

A comprehensive virulence study would need to evaluate:

  • Bacterial colonization and persistence in chicken tissues

  • Histopathological changes in infected tissues

  • Immune response modulation by wild-type versus ycjF-deficient strains

  • Mortality and clinical signs in experimental infection models

What role might ycjF play in developing vaccines against Salmonella gallinarum infections?

Recombinant ycjF protein could be exploited for vaccine development against fowl typhoid through several approaches:

  • Subunit Vaccine Development:

    • Purified recombinant ycjF could be formulated with appropriate adjuvants

    • Potential for inclusion in multi-antigen vaccines targeting multiple Salmonella proteins

    • Evaluation of different delivery systems for optimal immune response

  • Live Attenuated Vaccine Applications:

    • ycjF could be studied as a potential deletion target for attenuating Salmonella gallinarum

    • The ycjF gene might be modified to express immunogenic epitopes from other pathogens

    • Comparison with established attenuated strains like purB mutants

Recent research has demonstrated that live attenuated vaccines work better than inactivated or subunit vaccines against Salmonella infection, as they elicit stronger immune responses . A study on Salmonella gallinarum purB mutant showed promising results as a potential live attenuated vaccine candidate .

  • Vaccination Strategy Considerations:

    • Route of administration (oral versus parenteral)

    • Age of vaccination in poultry

    • Potential for cross-protection against other Salmonella serovars

Any vaccine development would require extensive safety and efficacy testing, including:

  • Assessment of residual virulence

  • Duration of immunity

  • Protection against challenge with virulent strains

  • Absence of reversion to virulence

What challenges are typically encountered when working with recombinant membrane proteins like ycjF?

Working with membrane proteins presents several technical challenges:

ChallengeDescriptionPotential Solutions
Low expression yieldMembrane proteins often express poorly in heterologous systems- Optimize codon usage for expression host
- Use specialized expression strains (e.g., C41/C43)
- Test different fusion tags and expression conditions
Protein misfoldingTransmembrane domains may not fold correctly in E. coli- Include molecular chaperones
- Lower expression temperature (16-25°C)
- Use membrane-mimetic environments during purification
AggregationHydrophobic regions can cause protein aggregation- Use appropriate detergents
- Include stabilizing agents like glycerol
- Optimize buffer conditions (pH, salt concentration)
Detergent selectionFinding the optimal detergent is critical- Screen multiple detergents (DDM, LDAO, etc.)
- Consider detergent mixtures
- Test detergent exchange during purification
Functional assessmentDifficult to verify proper folding and activity- Develop membrane-binding assays
- Circular dichroism for secondary structure
- Thermal stability assays

For ycjF specifically, researchers have successfully used N-terminal His-tags with expression in E. coli , suggesting this approach may overcome some of these challenges.

How can researchers verify the correct folding and functionality of recombinant ycjF protein?

Verifying correct folding and functionality of recombinant membrane proteins is challenging but essential:

  • Structural Verification Methods:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to probe folded state

    • Size exclusion chromatography to detect aggregation

  • Functional Verification Approaches:

    • Lipid binding assays to confirm membrane interaction

    • Reconstitution into liposomes or nanodiscs

    • Protein-protein interaction studies with known partners

    • In vitro activity assays (if function becomes known)

  • Quality Control Indicators:

    • Monodisperse elution profile during size exclusion chromatography

    • Resistance to proteolytic degradation

    • Stability during storage (minimal precipitation)

    • Consistent batch-to-batch behavior in functional assays

Without a known function for ycjF, researchers might need to rely on structural characteristics and comparisons with homologous proteins until specific functional assays can be developed.

What experimental design considerations are important when studying ycjF in Salmonella gallinarum pathogenesis?

When designing experiments to study ycjF in pathogenesis, several key considerations should be addressed:

  • Control Selection:

    • Include appropriate wild-type Salmonella gallinarum strains (e.g., strain 287/91 / NCTC 13346)

    • Consider complemented mutant strains to confirm phenotype specificity

    • Include positive controls with known virulence gene deletions (e.g., invA mutants)

  • Animal Model Considerations:

    • Use age-appropriate chickens (day-old for susceptibility studies)

    • Consider breed differences in susceptibility to Salmonella gallinarum

    • Include sufficient animal numbers for statistical power

    • Follow protocols similar to established infection models

  • Infection Parameters:

    • Standardize inoculum preparation and dosage (e.g., 2 × 10^8 CFU per bird in 100 μL PBS)

    • Define appropriate timepoints for sampling (3, 7, 10, 14, 21 days post-infection)

    • Select relevant tissues for bacterial colonization assessment (liver, spleen)

    • Establish clear scoring criteria for clinical symptoms and lesions

  • Readout Selection:

    • Bacterial loads in target organs

    • Histopathological examination

    • Immune response assessment (cellular and humoral)

    • Clinical signs and mortality rates

Research on Salmonella gallinarum has successfully used such experimental designs to evaluate gene function in pathogenesis, as demonstrated in studies of flagellar proteins and purine biosynthesis genes .

How can computational approaches complement laboratory studies of ycjF?

Computational approaches offer valuable complementary insights to laboratory studies of ycjF:

  • Sequence Analysis and Homology Modeling:

    • Predict secondary structure elements and transmembrane domains

    • Generate 3D models based on homologous proteins

    • Identify conserved motifs and potential functional sites

  • Genomic Context Analysis:

    • Examine gene neighborhood for functional associations

    • Analyze co-occurrence patterns across bacterial species

    • Identify potential operons containing ycjF

  • Protein-Protein Interaction Prediction:

    • Predict potential binding partners

    • Identify conserved interaction interfaces

    • Model docking with predicted partners

  • Evolutionary Analysis:

    • Analyze selection pressure on different protein regions

    • Identify critical conserved residues

    • Trace evolutionary history across bacterial species

  • Integration with Experimental Data:

    • Guide mutagenesis studies by identifying critical residues

    • Design domain deletion constructs based on structural predictions

    • Propose function based on similarity to characterized proteins

These computational approaches can generate testable hypotheses about ycjF function that can be validated through targeted laboratory experiments.

What are the most promising unresolved questions about Salmonella gallinarum ycjF protein?

Several key questions remain unanswered about ycjF protein that represent promising areas for future research:

  • Functional Characterization:

    • What is the specific biochemical function of ycjF?

    • Does it participate in known membrane-associated processes?

    • How does it contribute to bacterial physiology and fitness?

  • Structural Biology:

    • What is the three-dimensional structure of ycjF?

    • How does it integrate into the bacterial membrane?

    • Which domains are exposed to the periplasm versus cytoplasm?

  • Role in Pathogenesis:

    • Does ycjF contribute to Salmonella gallinarum virulence?

    • How does it compare to other membrane proteins in fowl typhoid pathogenesis?

    • Is it required for specific stages of infection?

  • Potential as Therapeutic Target:

    • Can ycjF be targeted for antimicrobial development?

    • Would antibodies against ycjF provide protection against infection?

    • Does it represent a novel vaccine candidate?

  • Regulatory Networks:

    • How is ycjF expression regulated during infection?

    • Does it respond to specific environmental cues?

    • What transcription factors control its expression?

Addressing these questions will require integrated approaches combining molecular genetics, biochemistry, structural biology, and infection biology.

How might ycjF research contribute to broader understanding of Salmonella pathogenesis?

Research on ycjF has potential to advance our understanding of Salmonella pathogenesis in several ways:

  • Membrane Protein Biology:

    • Improved understanding of membrane protein function in bacterial physiology

    • Insights into how membrane proteins contribute to host adaptation

    • Potential discovery of novel membrane-associated virulence mechanisms

  • Host-Pathogen Interactions:

    • Identification of novel host targets or receptors

    • Understanding of how bacteria modulate host responses through membrane proteins

    • Potential discovery of immune evasion strategies

  • Comparative Virulence Mechanisms:

    • Comparison between host-restricted (S. gallinarum) and broad-host (S. enteritidis) serovars

    • Understanding the molecular basis for host specificity

    • Identification of conserved versus specialized virulence factors

  • Vaccine Development Platform:

    • New approaches for subunit vaccine design

    • Understanding of protective antigens in fowl typhoid

    • Potential cross-protective strategies for multiple Salmonella serovars

Research has shown that Salmonella gallinarum and S. pullorum develop distinct host-pathogen relationships with chickens despite being very similar at the genomic level . Studies on genes like ycjF may help elucidate the molecular mechanisms driving these differences.

What methodological advances would accelerate research on membrane proteins like ycjF?

Several methodological advances would significantly accelerate research on membrane proteins like ycjF:

  • Expression and Purification Technologies:

    • Development of specialized expression hosts optimized for membrane proteins

    • Novel detergent-free solubilization approaches

    • High-throughput screening systems for optimal expression conditions

    • Automated purification platforms adapted for membrane proteins

  • Structural Biology Innovations:

    • Improved cryo-EM methodologies for smaller membrane proteins

    • Novel crystallization techniques for membrane proteins

    • Advanced computational approaches for structure prediction

    • Integrated structural biology pipelines combining multiple techniques

  • Functional Characterization Tools:

    • High-throughput assays for membrane protein interactions

    • Advanced imaging techniques for tracking membrane proteins in live bacteria

    • Biosensor development for monitoring membrane protein activity

    • New genetic tools for conditional expression/deletion

  • In vivo Analysis Approaches:

    • Improved animal models with tissue-specific reporters

    • Real-time monitoring of infection dynamics

    • Single-cell analysis of host-pathogen interactions

    • Advanced computational modeling of infection processes

These methodological advances would overcome current technical barriers and accelerate progress in understanding membrane proteins like ycjF in bacterial pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.