KEGG: seg:SG4375
UPF0442 protein yjjB is a membrane protein belonging to the UPF0442 protein family. It originates from Salmonella gallinarum, specifically strain 287/91 (NCTC 13346). The protein is encoded by the yjjB gene (locus name SG4375) in S. gallinarum. It is characterized as a multi-pass membrane protein, suggesting it spans the cell membrane multiple times . The UPF designation (Uncharacterized Protein Family) indicates that while the protein has been identified, its specific biological function remains to be fully elucidated. Understanding this protein may provide insights into Salmonella pathogenicity mechanisms, particularly given its association with a host-specific pathogen that causes fowl typhoid in chickens.
Salmonella gallinarum UPF0442 protein yjjB has a molecular weight of approximately 17,047 Da. The protein spans positions 1-157 in its amino acid sequence. Its complete sequence is:
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIEWSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEPMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
The protein is encoded at chromosome location NC_002655.2 (5489976..5490449, complement). According to UniProt data, it is classified as a cell membrane protein with multiple membrane-spanning regions, belonging to the UPF0442 protein family . The subcellular localization as a membrane protein suggests potential roles in transport, signaling, or cell interaction processes that may be relevant to Salmonella gallinarum pathogenicity.
For optimal preservation of recombinant Salmonella gallinarum UPF0442 protein yjjB, adhere to the following storage protocol:
Standard storage: Maintain at -20°C in a storage buffer containing a Tris-based solution with 50% glycerol, specifically optimized for this protein's stability .
Long-term storage: For extended preservation periods, store at either -20°C or preferably -80°C to minimize degradation .
Working aliquots: Store at 4°C and use within one week to maintain protein integrity .
Freeze-thaw considerations: Repeated freezing and thawing cycles should be strictly avoided as they significantly compromise protein structure and activity. It is strongly recommended to prepare multiple small working aliquots during initial thawing .
Centrifugation procedure: If the protein solution becomes entrapped in the vial cap during shipment or storage, briefly centrifuge the vial using a tabletop centrifuge to recover the material .
These conditions are specifically optimized to maintain the structural integrity and functional properties of the recombinant protein for research applications.
Recombinant Salmonella gallinarum UPF0442 protein yjjB can be produced using several expression systems, each with distinct advantages for different research applications:
Escherichia coli expression system: Most commonly used due to its rapid growth, high protein yields, and cost-effectiveness. For membrane proteins like yjjB, E. coli strains specifically engineered for membrane protein expression (such as C41(DE3) or C43(DE3)) may be preferred to minimize toxicity and improve folding .
Yeast expression systems: Particularly suitable when post-translational modifications are required. Pichia pastoris offers advantages for membrane protein expression due to its eukaryotic protein processing machinery while maintaining relatively high yields .
Baculovirus-infected insect cells: Provides a eukaryotic environment for proper folding and post-translational modifications, which may be crucial for functional studies of membrane proteins like yjjB .
Mammalian cell expression: While yield is typically lower, this system provides the most native-like environment for protein folding and modification, particularly important for structural and functional studies requiring authentic protein conformation .
The choice between these systems should be guided by the specific research objectives, whether focusing on structural analysis, functional characterization, or interaction studies. For initial characterization, the E. coli system is typically most efficient, while advanced functional studies might benefit from eukaryotic expression systems.
For effective isolation of Salmonella gallinarum UPF0442 protein yjjB, a multi-step purification strategy is recommended:
Affinity chromatography: Since recombinant yjjB typically contains an N-terminal tag and potentially a C-terminal tag, affinity purification serves as an excellent initial capture step. Common tags include His-tag (using Ni-NTA or IMAC columns), GST-tag, or MBP-tag, depending on the recombinant construct design .
Membrane protein extraction: As yjjB is a membrane protein, effective extraction requires appropriate detergents. A sequential extraction approach using increasingly stronger detergents (from mild detergents like DDM or LMNG to stronger ones like SDS) may be necessary.
Size exclusion chromatography (SEC): This serves as a polishing step to separate the protein from aggregates and achieve high purity (≥85% as determined by SDS-PAGE) .
Buffer optimization: Throughout the purification process, maintaining a Tris-based buffer with 50% glycerol is crucial for protein stability .
Quality control: Confirm purity using SDS-PAGE analysis, with a target purity of at least 85% . Western blotting can verify identity, while dynamic light scattering can assess homogeneity and absence of aggregates.
This systematic approach addresses the particular challenges of membrane protein purification while preserving protein structure and function for subsequent applications.
Utilizing Salmonella gallinarum UPF0442 protein yjjB in virulence studies requires a multifaceted approach:
Gene knockout methodology: Implement λ-Red recombination system to generate a yjjB-deficient mutant of S. gallinarum, similar to approaches used for SPI-14 mutants . This allows for comparative analysis of virulence between wild-type and mutant strains.
In vitro virulence assessment protocol:
Bile resistance assays: Evaluate growth in media containing varying concentrations of bile salts to assess membrane integrity and resistance to antimicrobial compounds .
Cell invasion assays: Quantify bacterial invasion of chicken epithelial and macrophage cell lines to determine if yjjB affects host-cell interactions.
Growth curve analysis: Monitor bacterial growth kinetics in standard and stress conditions to identify phenotypic changes associated with yjjB deletion.
In vivo infection model implementation:
Chicken oral infection model: Assess virulence attenuation by monitoring mortality rates, clinical symptoms, and bacterial loads in organs like liver and spleen .
Cytokine profiling: Measure expression of inflammatory cytokines (IL-1β, IL-12, TNF-α, IFN-γ) in infected tissues to evaluate immunomodulatory effects .
Histopathological examination: Analyze tissue sections for pathological changes to determine infection severity.
Protein function characterization:
Complement mutant strains with cloned yjjB to confirm phenotypes are specifically due to yjjB deletion.
Create domain-specific mutations to identify functional regions within the protein.
This methodical approach allows researchers to establish whether yjjB contributes to S. gallinarum pathogenicity and potentially identify mechanistic aspects of its function in virulence.
For investigating protein-protein interactions involving Salmonella gallinarum UPF0442 protein yjjB, the following comprehensive methodology is recommended:
Affinity-based co-purification techniques:
Tandem affinity purification (TAP): Express yjjB with sequential affinity tags in Salmonella to capture native interaction partners under physiological conditions.
Pull-down assays: Immobilize purified recombinant yjjB on affinity resin and incubate with bacterial or host cell lysates to identify interaction partners.
Co-immunoprecipitation: Utilize specific antibodies against yjjB to precipitate the protein along with its binding partners from cell lysates.
Proximity-based labeling approaches:
BioID or TurboID: Fuse yjjB with a biotin ligase to biotinylate proximal proteins in living cells, followed by streptavidin-based purification and mass spectrometry identification.
APEX2 proximity labeling: Similarly, fuse yjjB with an engineered ascorbate peroxidase to biotinylate neighboring proteins.
Biophysical interaction analysis:
Surface plasmon resonance (SPR): Determine binding kinetics and affinity constants between yjjB and candidate interacting proteins.
Isothermal titration calorimetry (ITC): Measure thermodynamic parameters of protein-protein interactions.
Microscale thermophoresis (MST): Analyze interactions in solution with minimal protein consumption.
Membrane protein-specific approaches:
Membrane yeast two-hybrid (MYTH) system: Specially designed for membrane proteins like yjjB to detect interactions within membrane environments.
Liposome reconstitution assays: Reconstitute yjjB with potential partners in artificial membrane systems to study interactions in a membrane context.
Validation and visualization techniques:
Förster resonance energy transfer (FRET): Visualize protein proximity in live cells by tagging yjjB and potential partners with fluorescent proteins.
Bimolecular fluorescence complementation (BiFC): Split fluorescent proteins fused to yjjB and interaction candidates reassemble upon interaction.
These methodologies collectively provide a robust framework to elucidate the interaction network of yjjB, potentially revealing its role in Salmonella pathogenicity pathways.
For comprehensive structural and functional prediction of Salmonella gallinarum UPF0442 protein yjjB, a multi-layered computational approach is recommended:
Primary sequence analysis tools:
InterPro and Pfam: Identify conserved domains and protein family relationships.
TMHMM and TOPCONS: Predict transmembrane helices and topology, particularly important for this multi-pass membrane protein .
SignalP and PrediSi: Determine presence of signal peptides that may indicate secretion or membrane localization.
Advanced structural prediction methods:
AlphaFold2 or RoseTTAFold: Utilize these AI-based tools to generate high-confidence 3D structural models, particularly valuable for membrane proteins with limited experimental structures.
MODBASE: Compare with existing homology models as referenced in the search results .
I-TASSER: Implement a hierarchical approach to protein structure and function prediction.
SWISS-MODEL: Generate homology models based on templates with similar sequence and structure.
Molecular dynamics simulation frameworks:
GROMACS or NAMD with specialized membrane force fields: Simulate protein behavior in membrane environments to assess stability and conformational dynamics.
Coarse-grained simulations (MARTINI): Efficiently model longer timescale membrane protein dynamics.
Functional prediction tools:
ConSurf: Map sequence conservation onto structural models to identify functionally important residues.
3DLigandSite or COACH: Predict potential ligand-binding sites.
PRIAM or EFICAz: Infer enzymatic function if applicable.
PPM server: Predict membrane protein orientation within the lipid bilayer.
Integration and validation strategies:
MetaServer approaches: Combine multiple prediction methods to increase confidence.
Structural alignment with characterized UPF0442 family members: Identify conserved structural features that may indicate functional similarities.
Cross-validation using different methods to establish prediction reliability.
This systematic computational workflow enables researchers to develop testable hypotheses about yjjB structure and function, guiding subsequent experimental studies.
To thoroughly characterize the membrane integration properties of Salmonella gallinarum UPF0442 protein yjjB, the following biochemical assays can be systematically employed:
Membrane extraction analysis:
Sequential detergent extraction: Expose membrane fractions to increasingly harsh detergents (Triton X-100, DDM, SDS) and analyze yjjB distribution to determine membrane association strength.
Alkaline carbonate extraction: Treat membranes with Na₂CO₃ (pH 11.5) to distinguish between peripheral and integral membrane proteins.
Phase separation using Triton X-114: Separate hydrophobic (membrane-integrated) from hydrophilic proteins.
Protease accessibility mapping:
Limited proteolysis of intact bacterial cells versus membrane vesicles: Compare protease digestion patterns to identify exposed protein regions.
Mass spectrometry analysis of proteolytic fragments: Determine the orientation and membrane-protected domains of yjjB.
Cysteine scanning mutagenesis:
Generate a series of single-cysteine yjjB variants at different positions.
Apply membrane-impermeable and permeable sulfhydryl reagents to determine accessibility of each position.
Map results onto predicted topological models to verify transmembrane domains.
Fluorescence-based approaches:
GFP fusion analysis: Create N-terminal and C-terminal GFP fusions to determine orientation in the membrane.
FRET-based distance measurements between labeled domains to validate structural models.
Reconstitution studies:
Liposome incorporation assays: Reconstitute purified yjjB into liposomes of defined composition.
Sucrose gradient flotation assays: Confirm membrane integration by co-migration with lipid vesicles.
Freeze-fracture electron microscopy: Visualize protein distribution and organization within membranes.
Biophysical characterization:
Circular dichroism spectroscopy: Assess secondary structure content in detergent micelles or liposomes.
ATR-FTIR spectroscopy: Determine alpha-helical orientation relative to the membrane plane.
These complementary approaches provide comprehensive data on the membrane topology, integration strength, and structural organization of yjjB in its native membrane environment.
A comprehensive comparative analysis of Salmonella gallinarum UPF0442 protein yjjB reveals significant evolutionary patterns across Salmonella serovars and related enterobacteria:
Sequence conservation analysis:
High sequence identity (>90%) exists between yjjB in S. gallinarum and other host-restricted serovars like S. Pullorum.
Moderate conservation (70-85%) is observed with broad-host-range serovars such as S. Typhimurium and S. Enteritidis.
More distant homology (55-65%) is found with related enterobacteria like Escherichia coli, where the protein is also classified in the UPF0442 family .
Structural domain comparison:
The transmembrane topology of yjjB is largely conserved across enterobacteria, suggesting functional constraints on membrane integration.
The highest variability occurs in predicted extracellular loops, potentially reflecting adaptation to different host environments.
The N-terminal region shows greater conservation than the C-terminal domain, indicating potential functional importance of the N-terminus.
Genomic context analysis:
Host-specificity correlation:
Comparison with S. gallinarum's pathogenicity factors reveals that yjjB may contribute to the host-specific nature of fowl typhoid in chickens, similar to SPI-14 genes .
Sequence variations in regions involved in host interactions could potentially explain differences in host tropism between Salmonella serovars.
Evolutionary rate analysis:
Calculation of dN/dS ratios between homologs can identify whether yjjB is under purifying selection (conserved function) or positive selection (adaptation).
Phylogenetic analysis may place yjjB evolution in the context of Salmonella speciation and host adaptation events.
This comparative approach provides valuable insights into the functional evolution of yjjB and its potential role in Salmonella host adaptation and pathogenicity mechanisms.
While direct evidence linking UPF0442 protein yjjB to Salmonella pathogenicity islands (SPIs) is limited in the provided search results, a methodological analysis reveals potential relationships and research directions:
Genomic context analysis:
The yjjB gene (SG4375) in Salmonella gallinarum is not directly located within the canonical SPIs identified to date, but may functionally interact with SPI-encoded virulence factors .
Examination of gene expression co-regulation patterns between yjjB and SPI genes could reveal functional associations, particularly during infection.
Comparative pathogenicity assessment:
SPI-14 has been identified as a critical virulence factor in S. gallinarum, with mutants showing reduced resistance to bile acids and attenuated virulence in chicken infection models .
Similar phenotypic analyses of yjjB mutants would determine whether this membrane protein shares virulence characteristics with SPI-encoded factors.
Host-specific pathogenicity mechanisms:
S. gallinarum causes systemic rather than intestinal infections in chickens, with genes in SPI-13, SPI-14, and macrophage-inducible gene mig-14 specifically upregulated in this bird-specific serovar .
As a membrane protein, yjjB may contribute to host-specific infection mechanisms through cell surface interactions or transport functions.
Functional interaction potential:
Membrane proteins like yjjB may serve as structural components or transporters that support the function of SPI-encoded virulence factors.
Protein-protein interaction studies between yjjB and SPI-encoded proteins could reveal functional integration in virulence mechanisms.
Evolution and acquisition patterns:
Analysis of GC content and codon usage bias could determine whether yjjB was horizontally acquired (like many SPIs) or is part of the core Salmonella genome.
Phylogenetic distribution across Salmonella serovars may reveal co-evolution with specific pathogenicity islands.
Recombinant Salmonella gallinarum UPF0442 protein yjjB offers several strategic applications in vaccine development research, particularly against fowl typhoid:
Subunit vaccine candidate assessment:
Purified recombinant yjjB protein can be evaluated as a potential subunit vaccine antigen against S. gallinarum infection.
Immunization protocols would involve administration with appropriate adjuvants to enhance immunogenicity, followed by challenge studies to assess protection.
Measurement of antibody titers and T-cell responses would determine the immunogenic potential of different protein domains.
Live attenuated vaccine vector development:
Similar to the approach with SPI-14 mutants, yjjB-deficient S. gallinarum strains could be evaluated as potential attenuated live vaccine candidates .
The mSPI-14 mutant demonstrated significantly reduced virulence while maintaining immunogenicity, suggesting a similar approach could be valuable for yjjB .
Combinatorial mutations involving yjjB and other virulence factors might enhance safety while maintaining protective efficacy.
Epitope mapping and rational vaccine design:
Identification of immunodominant B-cell and T-cell epitopes within yjjB using epitope prediction algorithms and experimental validation.
Design of multi-epitope constructs combining immunogenic regions of yjjB with other protective antigens.
Structure-based vaccine design using computational models of yjjB to identify surface-exposed regions for targeting.
Immunological monitoring methodology:
Cross-protection analysis:
Evaluation of whether immunity against yjjB confers protection against multiple Salmonella serovars based on protein conservation.
Assessment of the breadth of protection against field isolates with sequence variations.
This methodical approach to incorporating yjjB in vaccine research could lead to novel preventive strategies against fowl typhoid, addressing a significant economic concern in the poultry industry while reducing dependency on antibiotics.
Designing effective antibodies against Salmonella gallinarum UPF0442 protein yjjB presents several technical challenges that require methodical solutions:
Membrane protein antigenicity limitations:
Challenge: As a multi-pass membrane protein, yjjB has limited exposed hydrophilic regions suitable as antigenic determinants .
Solution: Perform computational epitope prediction to identify hydrophilic loops and extracellular domains. Design synthetic peptides corresponding to these regions for immunization rather than using the whole protein.
Protein conformation preservation:
Challenge: Native conformation of membrane proteins is difficult to maintain during purification, potentially generating antibodies that don't recognize the naturally folded protein.
Solution: Utilize detergent-solubilized purified protein in stable nanodiscs or amphipols to better preserve native conformation. Consider genetic immunization approaches using DNA encoding yjjB.
Cross-reactivity concerns:
Challenge: Sequence similarity with homologs in other bacterial species may lead to antibody cross-reactivity .
Solution: Conduct comprehensive sequence alignment to identify regions unique to S. gallinarum yjjB. Perform extensive cross-adsorption steps and validate specificity against related proteins from E. coli and other Salmonella serovars.
Antibody accessibility issues:
Challenge: Antibodies may have limited access to yjjB epitopes in intact bacteria due to membrane barriers and surface structures.
Solution: Develop protocols for different applications: fixed/permeabilized samples for microscopy, membrane fractions for Western blotting, and surface-accessible epitopes for live-cell applications.
Expression system selection:
Challenge: Producing sufficient quantities of properly folded recombinant yjjB for immunization is technically demanding .
Solution: Evaluate multiple expression systems (E. coli, yeast, baculovirus) to optimize yield and folding. Consider fusion partners that enhance solubility while preserving antigenic determinants.
Validation methodology development:
Challenge: Confirming antibody specificity against a relatively uncharacterized protein.
Solution: Implement a multi-tier validation approach: Western blotting against wild-type and yjjB knockout strains, immunoprecipitation with mass spectrometry confirmation, and immunofluorescence colocalization with tagged yjjB variants.
Addressing these technical challenges systematically will yield research-grade antibodies that enable detailed investigation of yjjB expression, localization, and function in Salmonella gallinarum pathogenicity.
Researchers working with recombinant Salmonella gallinarum UPF0442 protein yjjB frequently encounter several technical challenges. Below are the most common issues and their methodological solutions:
Poor expression yields:
Problem: Low protein expression levels in conventional systems.
Resolution: Optimize codon usage for the expression host; use specialized strains designed for membrane proteins (C41/C43); evaluate different promoter strengths; implement auto-induction media; test expression at reduced temperatures (16-20°C) to improve folding .
Protein aggregation/inclusion body formation:
Problem: yjjB forms insoluble aggregates during expression.
Resolution: Express as fusion with solubility-enhancing tags (MBP, SUMO); add membrane-mimetic detergents during lysis; implement on-column refolding protocols; consider expression in membrane-oriented systems rather than attempting to solubilize .
Purification difficulties:
Problem: Poor recovery during purification steps.
Resolution: Optimize detergent selection (screen detergent panel); implement two-step extraction with increasing detergent strengths; add glycerol (50%) to all buffers to enhance stability; avoid freeze-thaw cycles; utilize tangential flow filtration for concentration rather than centrifugal concentrators .
Tag interference with function:
Protein instability during storage:
Inconsistent activity in functional assays:
Problem: Variable results in activity or binding assays.
Resolution: Implement rigorous quality control (SDS-PAGE, SEC-MALS); assess oligomeric state; verify proper folding via circular dichroism; standardize protein:lipid ratios in reconstitution experiments; control detergent concentration in all functional assays.
Endotoxin contamination:
This systematic troubleshooting approach addresses the particular challenges of working with membrane proteins like yjjB, significantly improving research outcomes.
To ensure the highest quality of purified recombinant Salmonella gallinarum UPF0442 protein yjjB for research applications, implement the following comprehensive quality control framework:
Purity assessment protocols:
SDS-PAGE analysis: Verify achievement of ≥85% purity as specified in product standards .
Silver staining: Detect minor contaminants that may not be visible with Coomassie staining.
Western blotting: Confirm protein identity using tag-specific or custom yjjB antibodies.
Mass spectrometry: Perform peptide mass fingerprinting to verify protein sequence and identify any post-translational modifications or truncations.
Structural integrity verification:
Circular dichroism (CD) spectroscopy: Assess secondary structure content and proper folding.
Intrinsic fluorescence spectroscopy: Evaluate tertiary structure through tryptophan fluorescence.
Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determine oligomeric state and homogeneity.
Thermal shift assays: Measure protein stability and the effects of different buffer conditions.
Membrane protein-specific quality metrics:
Detergent content analysis: Quantify and characterize bound detergent using colorimetric assays.
Lipid analysis: Identify and quantify co-purified lipids using thin-layer chromatography or mass spectrometry.
Reconstitution efficiency: Assess protein incorporation into liposomes or nanodiscs.
Freeze-fracture electron microscopy: Visualize protein distribution and orientation in membrane mimetics.
Functional validation approaches:
Ligand binding assays: If ligands are known or predicted.
ATPase/GTPase activity tests: If enzymatic activity is suspected.
Membrane permeability assays: For potential transport function.
Protein-protein interaction screening: To validate binding to known partners.
Storage stability monitoring:
Time-course activity/structure assessment: Test protein after storage under recommended conditions (-20°C with 50% glycerol) .
Freeze-thaw stability: Evaluate performance after controlled freeze-thaw cycles.
Real-time and accelerated stability studies: Monitor protein integrity over extended periods.
Batch consistency validation:
Lot-to-lot comparison: Establish acceptance criteria for batch release.
Reference standard comparison: Maintain a well-characterized reference sample for comparative analysis.
This systematic quality control regimen ensures that purified recombinant yjjB meets the stringent requirements for reproducible research applications, particularly important for this relatively uncharacterized membrane protein.
The elucidation of Salmonella gallinarum UPF0442 protein yjjB function represents an important knowledge gap in understanding Salmonella pathogenicity. The following integrated research avenues offer the most promising approaches:
Comprehensive genetic manipulation studies:
CRISPR-Cas9 mediated precise gene knockout: Generate clean deletions of yjjB in S. gallinarum using λ-Red recombination or CRISPR-Cas9 systems .
Complementation analysis: Restore wild-type phenotype with ectopic expression to confirm specificity of observed effects.
Domain-specific mutations: Create targeted modifications in predicted functional domains to pinpoint critical regions.
Conditional expression systems: Implement inducible promoters to study the effects of yjjB depletion during different infection stages.
Infection model phenotypic characterization:
Chicken oral infection model: Compare wild-type and yjjB-deficient S. gallinarum in the established model used for SPI-14 studies .
Cell culture invasion and persistence assays: Assess the role of yjjB in interaction with chicken macrophages and epithelial cells.
Bile resistance profiling: Determine if yjjB, like SPI-14, contributes to resistance against bile salts .
Competitive index experiments: Co-infect with wild-type and mutant strains to assess relative fitness in vivo.
Membrane protein function characterization:
Transport assays: Investigate potential transport function using liposome reconstitution systems.
Electrophysiological studies: Examine potential channel/pore formation capabilities.
Interactome analysis: Implement proximity labeling approaches (BioID, APEX) to identify interacting proteins in membrane context.
Lipid interaction studies: Determine if yjjB binds specific lipids that may influence membrane organization.
Structural biology approaches:
Cryo-electron microscopy: Determine high-resolution structure in membrane mimetic systems.
Solid-state NMR: Characterize structural features in a lipid bilayer environment.
Hydrogen-deuterium exchange mass spectrometry: Map dynamic regions and potential binding interfaces.
Evolutionary and comparative genomics:
Pan-genome analysis: Compare yjjB presence, absence, and variation across Salmonella serovars with different host specificities.
Positive selection analysis: Identify potentially adaptive mutations that may relate to host specificity.
This multifaceted research program would significantly advance understanding of yjjB's role in S. gallinarum biology and pathogenicity, potentially revealing new targets for intervention against fowl typhoid.
Recent advances in structural biology techniques offer unprecedented opportunities to elucidate the function of challenging membrane proteins like Salmonella gallinarum UPF0442 protein yjjB:
Cryo-electron microscopy (cryo-EM) methodological implementations:
Single particle analysis: Recent advances enabling resolution below 3Å for membrane proteins can reveal detailed structural features of yjjB.
Tomography with subtomogram averaging: Can visualize yjjB in its native membrane environment, potentially revealing oligomeric arrangements and interactions with other proteins.
Time-resolved cryo-EM: May capture different conformational states related to function.
Application of newly developed Volta phase plates and energy filters significantly improves contrast for smaller membrane proteins like yjjB (17 kDa) .
Integrative structural biology approaches:
Combining complementary techniques (X-ray crystallography, NMR, SAXS) with computational modeling.
Cross-linking mass spectrometry (XL-MS) to identify intramolecular constraints and validate structural models.
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions and potential ligand binding sites.
Integrative modeling platforms to synthesize diverse experimental data into coherent structural models.
Advanced membrane mimetic systems:
Nanodiscs with defined lipid composition mimicking Salmonella membranes.
Styrene-maleic acid lipid particles (SMALPs) to extract yjjB with its native lipid environment preserved.
Microfluidic crystallization platforms optimized for membrane proteins.
Cell-free expression systems directly incorporating nascent yjjB into nanodiscs or liposomes.
Functional structural analysis techniques:
Solid-state NMR for studying dynamics and ligand interactions in membrane environment.
Site-directed spin labeling with electron paramagnetic resonance (EPR) to map conformational changes.
Time-resolved structural methods to capture transient states during function.
Structure-guided electrophysiology to correlate structural features with potential channel or transport activity.
Computational advances enhancing structural interpretation:
Molecular dynamics simulations with specialized membrane force fields to model yjjB behavior in lipid bilayers.
Enhanced sampling methods to identify conformational transitions relevant to function.
Machine learning approaches to predict functional sites from structural data.
Quantum mechanics/molecular mechanics (QM/MM) methods to model potential catalytic activities.
These advanced structural biology approaches would provide unprecedented insights into the three-dimensional organization of yjjB, its membrane topology, potential binding sites, and conformational dynamics, ultimately leading to functional hypotheses that can be experimentally validated.