Recombinant Salmonella gallinarum UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Immunoassays and Antibody Production

The protein is commercially available as an ELISA reagent (e.g., Creative BioMart Cat. No. RFL4714SF) for antibody validation and diagnostic assays . Its immunogenicity is leveraged to study host-pathogen interactions in avian models .

Vaccine Development

While not directly tested in vaccine trials, recombinant YihY is part of broader efforts to engineer attenuated S. gallinarum strains. For example:

  • Deletion of virulence genes (e.g., SpvB) in S. gallinarum reduces pathogenicity, enabling vaccine vector development .

  • SPI-14 mutants lacking SG0835-SG0836 genes show attenuated virulence, highlighting the role of membrane proteins in systemic infections .

Pathogenicity Associations

  • SPI-1/SPI-2 Independence: Unlike S. enteritidis or S. typhimurium, S. gallinarum virulence relies minimally on SPI-1/SPI-2 secretion systems, implying alternative pathways involving membrane proteins like YihY .

  • Bile Resistance: SPI-14 mutants (linked to membrane function) exhibit reduced bile tolerance, indirectly implicating YihY in environmental adaptation .

Comparative Analysis of Recombinant YihY Variants

Recombinant YihY is produced across Salmonella and E. coli strains with conserved features :

Host SpeciesExpression SystemPurityPrimary Use
S. gallinarum (NCTC 13346)E. coli≥85%Immunoassays
S. dublinE. coli≥85%Structural studies
E. coli O157:H7Mammalian cells≥85%Pathogenicity studies

Challenges and Future Directions

  • Functional Gaps: The exact role of YihY in S. gallinarum virulence remains uncharacterized .

  • Vaccine Potential: Engineered S. gallinarum strains (e.g., ΔSpvB_SG18) could serve as vectors to deliver YihY antigens, but this requires validation .

  • Cross-Reactivity: Antibodies against YihY may recognize homologs in other Enterobacteriaceae, necessitating specificity tests .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yihY; SG3398; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Target Names
yihY
Target Protein Sequence
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
Uniprot No.

Target Background

Database Links

KEGG: seg:SG3398

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of UPF0761 membrane protein yihY in Salmonella gallinarum?

The yihY protein (UniProt ID: B5RFE6) is a full-length (290 amino acids) membrane protein with a sequence that begins with mLKTVHQKAGRHTRPVRAW and continues through to LGEYRKLKQAAEQEEADQP at the C-terminus . It belongs to the UPF0761 protein family, characterized as a membrane protein with a predominantly hydrophobic amino acid composition consistent with its integration into bacterial membranes . The protein contains multiple transmembrane domains as evidenced by its hydrophobicity profile and structural predictions, making it an integral membrane protein rather than a peripheral membrane-associated protein. Structurally, yihY likely adopts a conformation with several membrane-spanning helices connected by both intracellular and extracellular loops, though definitive high-resolution structural data remains limited.

How does Salmonella gallinarum yihY compare with orthologous proteins in other Salmonella species?

The yihY protein shows high sequence conservation across Salmonella species, with particularly notable similarity between S. gallinarum (UniProt: B5RFE6) and S. enteritidis PT4 (UniProt: B5QWW1) . Sequence alignment reveals minimal variations primarily in non-critical regions, suggesting functional conservation. Both proteins share identical length (290 amino acids) and highly similar hydrophobicity profiles. The amino acid sequences are nearly identical, with the most conserved regions likely corresponding to transmembrane domains and functional motifs. This high degree of conservation indicates that research findings regarding structure-function relationships may be transferable between these species, though species-specific variations in expression levels or regulatory mechanisms may exist.

What is currently understood about yihY protein function based on bioinformatic predictions?

While definitive functional characterization remains incomplete, bioinformatic analyses suggest potential roles in membrane transport or signaling . The protein contains sequence motifs consistent with ion channel or transporter activity, though experimental validation is needed. Comparative genomic analyses place yihY among proteins with undetermined function (UPF designation), indicating limited functional annotation despite widespread conservation across bacterial species . Transmembrane topology predictions suggest 7-8 transmembrane segments with both N and C termini likely oriented toward the cytoplasm. Co-expression network analyses suggest potential functional relationships with other membrane proteins involved in stress response or metabolic processes, providing direction for future experimental investigation into protein-protein interactions and cellular pathways.

What expression systems yield optimal production of functional recombinant yihY protein?

E. coli represents the preferred heterologous expression system for recombinant yihY production, with BL21(DE3) or similar strains demonstrating suitable expression levels . For functional studies, careful consideration of membrane protein expression parameters is essential. Expression protocols typically employ IPTG induction (0.1-1.0 mM) at reduced temperatures (16-25°C) to minimize inclusion body formation and promote proper membrane insertion. Expression vectors incorporating N-terminal His-tags facilitate subsequent purification while minimizing interference with membrane insertion . For enhanced membrane protein expression, specialized E. coli strains (C41/C43) or expression vectors containing fusion partners (MBP, SUMO) may improve folding and stability. Expression levels are typically confirmed by Western blotting using anti-His antibodies or custom antibodies against yihY-specific epitopes.

What purification strategies effectively isolate yihY while maintaining native conformation?

Purification of membrane proteins like yihY requires careful consideration of detergent selection and concentration to maintain native structure. Initial membrane isolation via ultracentrifugation followed by detergent solubilization (typically using mild non-ionic detergents like DDM or LMNG at 1-2% w/v) preserves functional integrity . For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin represents the primary purification step, typically achieving >90% purity . Critical parameters include imidazole concentration in wash buffers (20-40 mM) and elution buffers (250-500 mM). Secondary purification steps may include size exclusion chromatography to remove aggregates and ensure homogeneity. Purified protein is best maintained in buffers containing Tris/PBS base with 6% trehalose at pH 8.0 and 0.01-0.05% detergent to prevent aggregation .

What analytical methods can assess structural integrity of purified yihY protein?

Structural integrity assessment combines multiple complementary techniques. Circular dichroism spectroscopy provides valuable data on secondary structure content, particularly alpha-helical content expected for transmembrane domains. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can evaluate monodispersity and oligomeric state. Thermal stability assays using differential scanning fluorimetry with appropriate detergent-compatible dyes help optimize buffer conditions. Limited proteolysis followed by mass spectrometry identifies stable domains and flexible regions. For membrane proteins like yihY, fluorescence-based assays can monitor proper folding through intrinsic tryptophan fluorescence or using environment-sensitive dyes. Active conformation can be indirectly assessed through binding assays with putative interaction partners or ligands, though specific binding partners for yihY remain to be identified conclusively.

What methodologies are recommended for investigating yihY membrane topology?

Multiple complementary approaches provide robust topology data. Cysteine scanning mutagenesis combined with accessibility studies using membrane-impermeable thiol-reactive reagents can map transmembrane organization. This involves systematically replacing native amino acids with cysteine residues and assessing their accessibility to reagents like maleimide derivatives. Fluorescence-based approaches using environment-sensitive probes attached to specific positions provide dynamic information about membrane interactions. Protease protection assays, where proteases are applied to intact bacterial cells or isolated membrane vesicles, determine which regions are protected by the membrane. Computational prediction tools (TMHMM, TOPCONS) provide initial models that guide experimental design, predicting yihY contains multiple transmembrane helices. Reporter fusion constructs using alkaline phosphatase (PhoA) or green fluorescent protein (GFP) at various positions can experimentally validate predicted topology based on activity or fluorescence intensity.

How can researchers investigate potential transport functions of yihY protein?

For transport function investigation, reconstitution into proteoliposomes represents the gold standard approach. This involves purifying yihY using appropriate detergents, then incorporating it into artificial liposomes containing fluorescent substrate indicators or ion-sensitive dyes. Inside-out membrane vesicles prepared from bacteria expressing yihY can be used to measure substrate accumulation or ion flux. Electrophysiological techniques, particularly planar lipid bilayer recordings, can directly measure channel or transporter activity at the single-molecule level. Complementation studies in bacterial strains deficient in specific transporters may reveal substrate specificity. Substrate-induced conformational changes can be monitored using techniques such as tryptophan fluorescence quenching, hydrogen-deuterium exchange mass spectrometry, or EPR spectroscopy with site-specific spin labels. These approaches are particularly relevant given the membrane localization of yihY and structural features suggesting potential transport functions.

What genetic approaches effectively investigate yihY function in Salmonella gallinarum?

Gene knockout or deletion represents the primary approach for functional studies. The CRISPR/Cas9 system has proven effective for Salmonella gene editing, allowing precise deletion of target genes while minimizing polar effects . Lambda Red recombination technology offers an alternative approach for generating markerless deletions, similar to strategies used for other Salmonella genes . Complementation studies involving reintroduction of wild-type or mutated yihY variants can confirm phenotype specificity. Conditional expression systems using inducible promoters allow studying essential genes or toxic phenotypes. For subtle effects, competitive infection assays in appropriate host models can detect fitness defects not apparent in single-strain infections. RNA-seq analysis comparing wild-type and yihY mutant strains under various conditions can reveal affected pathways and potential functions. Protein-protein interaction screens using bacterial two-hybrid systems or co-immunoprecipitation followed by mass spectrometry may identify functional partners.

How can researchers evaluate the potential role of yihY in Salmonella gallinarum virulence?

Virulence assessment requires well-designed infection models. For S. gallinarum, which causes fowl typhoid, chicken infection models represent the most relevant system . Following established protocols, 3-day-old chickens can be orally inoculated with wild-type and yihY-deficient strains (typically 108 CFU/bird in 100 μL PBS) . Clinical signs and mortality should be monitored daily, with scoring systems for depression and diarrhea similar to those used in other Salmonella studies. Post-mortem examination should assess gross lesions in liver and spleen, using established scoring criteria . Bacterial persistence can be evaluated by collecting organ samples at defined timepoints (3, 7, 10, 14, and 21 days post-infection) for bacterial enumeration on selective media following homogenization and serial dilution . Complementation with wild-type yihY should restore virulence phenotypes if the protein contributes to pathogenesis. Histopathological examination and immunohistochemistry can provide additional insights into tissue tropism and host responses.

What host cell culture models are appropriate for studying yihY function in host-pathogen interactions?

For S. gallinarum research, primary chicken macrophages and chicken epithelial cell lines represent the most relevant in vitro models. Invasion assays using these cells can compare wild-type and yihY-deficient strains for adhesion, invasion, and intracellular survival capabilities. Gentamicin protection assays represent the standard methodology, with cells infected at a multiplicity of infection (MOI) of 10-50 bacteria per cell for 30-60 minutes, followed by gentamicin treatment to kill extracellular bacteria. Intracellular bacteria are enumerated at various timepoints by cell lysis and plating on selective media. Confocal microscopy using fluorescently labeled bacteria can visualize intracellular localization and potential co-localization with host cell compartments. Transcriptomic or proteomic analysis of infected host cells can identify differentially regulated pathways between wild-type and yihY-deficient infections. For membrane proteins like yihY, examining potential interactions with host cell membrane components using pull-down assays or proximity labeling approaches may reveal direct host targets.

How should researchers design yihY knockout strains to minimize polar effects on adjacent genes?

Creating precise gene deletions without affecting neighboring genes requires careful design. Markerless deletion strategies using lambda Red recombination or CRISPR/Cas9 systems minimize disruption of adjacent gene expression . For yihY knockout design, researchers should analyze the genomic context to identify potential operonic structures or overlapping regulatory elements. PCR primers for homologous recombination should be designed to precisely remove the coding sequence while preserving ribosome binding sites of downstream genes. The scarless approach leaves only a minimal genomic scar (typically <50 bp) following removal of any selection markers . RT-PCR or RNA-seq analysis should confirm that expression of flanking genes remains unaffected in the mutant strain. Complementation studies using plasmid-expressed yihY under its native promoter are essential to confirm phenotype specificity. If polar effects cannot be avoided, alternative approaches include point mutations that introduce premature stop codons or site-directed mutagenesis of predicted functional residues.

What structural biology approaches are most promising for resolving yihY three-dimensional structure?

Membrane protein structural determination presents significant challenges requiring specialized approaches. X-ray crystallography remains a gold standard but requires extensive optimization of detergent conditions, lipid composition, and crystallization parameters. For yihY protein, vapor diffusion methods with specialized membrane protein crystallization screens represent the initial approach. Lipidic cubic phase crystallization provides an alternative membrane-mimetic environment that often yields better diffraction quality crystals for membrane proteins. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and may be particularly suitable for yihY, especially if it forms oligomeric assemblies. Sample preparation using amphipols, nanodiscs, or reconstitution into lipid nanodiscs can improve stability and homogeneity for cryo-EM studies. Nuclear magnetic resonance (NMR) spectroscopy, particularly solid-state NMR, can provide structural information for membrane proteins in native-like lipid environments, though size limitations may present challenges for the 290-amino acid yihY protein .

How can researchers utilize computational approaches to predict yihY function from sequence data?

Computational approaches provide valuable hypotheses to guide experimental design. Homology modeling using templates from structurally characterized membrane proteins can generate preliminary structural models. Tools incorporating evolutionary coupling analysis (such as AlphaFold) have dramatically improved membrane protein structure prediction accuracy. Molecular dynamics simulations in explicit membrane environments can reveal dynamic properties and potential conformational changes. Substrate docking simulations may identify potential binding pockets and interaction partners. Analysis of conserved residues across multiple species can highlight functionally important regions. Co-evolution analysis can identify potential interaction partners based on correlated mutations across multiple genomes. Sequence-based classification approaches place yihY within the UPF0761 family, though functional annotation remains limited . Integration of multiple prediction methods, including gene neighborhood analysis, can strengthen functional hypotheses by revealing consistently co-occurring genes across diverse bacterial genomes.

What methodological approaches can determine if yihY forms homo-oligomeric structures in membranes?

Oligomerization analysis requires specialized techniques suitable for membrane proteins. Blue native PAGE using mild detergent solubilization can preserve native oligomeric states while providing molecular weight estimates. Chemical crosslinking followed by SDS-PAGE and Western blotting can capture transient interactions, with crosslinkers of varying lengths providing distance constraints. Förster resonance energy transfer (FRET) between differentially labeled yihY molecules can detect oligomerization in membranes with nanometer resolution. Single-molecule approaches, including single-particle tracking in live bacteria or fluorescence correlation spectroscopy, can reveal dynamic oligomerization. Analytical ultracentrifugation using detergent-solubilized protein provides quantitative affinity and stoichiometry measurements. Native mass spectrometry with specialized ionization techniques has emerged as a powerful approach for membrane protein complexes. For definitive structural characterization, cryo-EM is particularly well-suited for membrane protein complexes, potentially revealing the arrangement of subunits within oligomeric assemblies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.