Recombinant Salmonella heidelberg 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Function

The S. heidelberg ubiA protein is a 290-amino-acid enzyme (UniProt ID: B4TDL7) with a predicted molecular weight of ~32 kDa . Its primary role is the transfer of octaprenyl groups to 4-HB, initiating coenzyme Q synthesis. This reaction is essential for maintaining membrane integrity and electron transport efficiency in bacteria .

Coenzyme Q Biosynthesis Studies

  • Pathway Elucidation: UbiA is the first enzyme in the coenzyme Q pathway, making it a target for studying metabolic regulation in Salmonella .

  • Antimicrobial Targeting: Inhibitors of ubiA could disrupt coenzyme Q production, impairing bacterial survival .

Vaccinology and Pathogenicity

  • Immune Response: Recombinant ubiA is used to study Salmonella surface proteins and their role in host-pathogen interactions .

  • Biofilm Disruption: Salmonella biofilms are linked to persistence in poultry environments; ubiA may influence membrane stability, affecting biofilm formation .

Antimicrobial Resistance

  • Multidrug Resistance (MDR): S. heidelberg isolates often exhibit MDR due to horizontal gene transfer. UbiA’s role in stress response may indirectly influence survival under antibiotic pressure .

A. Genomic Context in S. heidelberg

  • Stress Tolerance: Outbreak-associated S. heidelberg isolates show enhanced heat tolerance and biofilm formation, potentially linked to coenzyme Q-mediated membrane stability .

  • Antimicrobial Resistance Genes: MDR strains carry genes like blaCTX-M-2 (β-lactam resistance) and tet(A) (tetracycline resistance), but no direct link to ubiA has been established .

Key Challenges and Future Directions

  • Expression Optimization: Partial constructs (e.g., 1–242 aa) may lack critical domains, necessitating full-length production for accurate functional assays .

  • Target Validation: Further studies are needed to confirm ubiA as a viable therapeutic target in S. heidelberg infections.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; SeHA_C4576; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It facilitates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Salmonella heidelberg?

4-hydroxybenzoate octaprenyltransferase (ubiA) in Salmonella heidelberg belongs to the UbiA superfamily of intramembrane prenyltransferases that catalyze a key biosynthetic step in the production of ubiquinones . The specific reaction involves the prenylation of p-hydroxybenzoate (PHB), where the enzyme fuses an isoprenyl chain to the meta-position of PHB . This reaction is essential for the biosynthesis of ubiquinone (coenzyme Q), which serves as an electron and proton carrier in the respiratory chain of the bacterium . The enzyme is embedded in the membrane, which enables it to access both water-soluble aromatic substrates and lipid-soluble prenyl donors, making it crucial for energy metabolism in Salmonella heidelberg .

How does the ubiA gene in Salmonella heidelberg differ from its counterparts in other bacterial species?

The ubiA gene in Salmonella heidelberg shares the core catalytic domain structure with other members of the UbiA superfamily, but exhibits species-specific variations in substrate binding sites and membrane integration regions. Comparative genomic analysis reveals that while the catalytic mechanism is conserved across bacterial species, the Salmonella heidelberg ubiA may contain unique amino acid substitutions that affect substrate specificity and reaction efficiency. These variations may contribute to the organism's survival capabilities in different environments.

What role might ubiA play in antimicrobial resistance in Salmonella heidelberg strains?

While not directly involved in antibiotic resistance mechanisms, the ubiA enzyme may indirectly contribute to Salmonella heidelberg's survival under antimicrobial pressure through its essential role in energy metabolism. Salmonella heidelberg isolates, particularly from swine sources, demonstrate high rates of multidrug resistance, with 73.3% showing resistance to streptomycin, tetracycline, and kanamycin . This resistance pattern suggests that maintaining efficient energy metabolism through functional ubiquinone biosynthesis could be critical for expressing energy-dependent resistance mechanisms.

The relationship between ubiquinone biosynthesis and antibiotic resistance may involve several aspects:

  • Energy provision for efflux pumps that export antibiotics from bacterial cells

  • Maintenance of membrane potential necessary for cell survival under stress conditions

  • Support for bacterial growth and division to overcome bacteriostatic effects of certain antibiotics

While direct evidence linking ubiA mutations to resistance profiles is limited, the essential nature of this enzyme makes it a potential indirect contributor to antimicrobial tolerance in multidrug-resistant Salmonella heidelberg strains .

What are the optimal experimental conditions for expressing recombinant Salmonella heidelberg ubiA in E. coli?

The optimal experimental conditions for expressing recombinant Salmonella heidelberg ubiA in E. coli involve careful selection of expression vectors, host strains, and induction parameters. Based on established protocols for membrane protein expression, the following methodology is recommended:

  • Vector selection: pET-based vectors with T7 promoter systems offer tight regulation and high expression levels. The pET28a(+) vector with an N-terminal His-tag facilitates purification while minimizing interference with membrane insertion.

  • Host strain: E. coli C41(DE3) or C43(DE3) strains are preferred as they are specifically engineered for membrane protein expression and can tolerate the potential toxicity of overexpressed membrane proteins.

  • Growth conditions:

    • Medium: Terrific broth supplemented with 0.5% glucose

    • Temperature: Initial growth at 37°C until OD600 reaches 0.6-0.8

    • Post-induction temperature: 18-20°C for 16-20 hours

  • Induction parameters:

    • IPTG concentration: 0.1-0.2 mM (lower concentrations favor proper membrane insertion)

    • Addition of 5% glycerol to the medium post-induction improves protein stability

  • Membrane fraction isolation:

    • Cell disruption via sonication or French press in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol

    • Sequential centrifugation to separate membrane fractions

This methodology employs the principles of true experimental design by controlling variables such as temperature, medium composition, and induction parameters to optimize the yield and functionality of the recombinant enzyme .

How can researchers design experiments to evaluate the kinetic parameters of recombinant ubiA?

Designing experiments to evaluate the kinetic parameters of recombinant ubiA requires a systematic approach that accounts for its membrane-bound nature and dual-substrate reaction. An effective experimental design includes:

  • Preparation of enzyme in native-like environment:

    • Purify the enzyme in detergent micelles (e.g., DDM or LMNG)

    • Alternatively, reconstitute in proteoliposomes or nanodiscs to better mimic the native membrane environment

  • Substrate preparation:

    • For p-hydroxybenzoate (PHB): Prepare water-soluble stocks at various concentrations (0.1-500 μM)

    • For prenyl donor (e.g., octaprenyl pyrophosphate): Prepare in detergent-containing buffer at various concentrations (0.1-100 μM)

  • Reaction monitoring approach:

    • Direct measurement: HPLC-based quantification of prenylated product formation

    • Coupled enzyme assay: Monitoring pyrophosphate release using commercially available enzymatic assays

    • Radiolabeled substrate approach: Using 14C-labeled PHB to track product formation

  • Experimental design for determining kinetic parameters:

    • For Km and Vmax determination: Matrix of reactions with varying concentrations of both substrates

    • For PHB: 8-10 concentrations spanning 0.1-10× the estimated Km

    • For prenyl donor: 8-10 concentrations spanning 0.1-10× the estimated Km

    • Fixed-time assays at 3-5 timepoints to ensure linearity of reaction

  • Data analysis:

    • Initial velocity determination from linear portion of progress curves

    • Michaelis-Menten, Lineweaver-Burk, or Eadie-Hofstee plots for parameter calculation

    • For bi-substrate kinetics: Appropriate models (ping-pong or sequential) determined through product inhibition studies

This experimental design incorporates randomization of experimental runs and appropriate controls to account for substrate degradation and enzyme stability, adhering to principles of rigorous experimental design .

What techniques are available for detecting and quantifying the enzymatic activity of ubiA?

Several analytical techniques are available for detecting and quantifying the enzymatic activity of ubiA, each with specific advantages depending on research objectives:

  • Chromatographic methods:

    • HPLC with UV detection: Separation of substrate and prenylated product with detection at 275 nm

    • LC-MS/MS: Provides both separation and structural confirmation of prenylated products with high sensitivity

    • TLC with phosphorimaging: When using radiolabeled substrates, enables visualization and quantification of products

  • Spectroscopic methods:

    • UV spectroscopy: Monitoring changes in absorbance spectra upon prenylation

    • Fluorescence-based assays: Using fluorescently-labeled substrates or products to enhance sensitivity

  • Radiochemical methods:

    • Incorporation of 14C-labeled PHB or 3H-labeled prenyl donor

    • Scintillation counting of extracted products or filter-binding assays

  • Coupled enzyme assays:

    • Pyrophosphate release detection using enzymatic cascades

    • Colorimetric or fluorometric readouts for high-throughput applications

  • Novel approaches:

    • Surface plasmon resonance for real-time binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Nanoscale differential scanning fluorimetry for substrate binding effects on protein stability

Each technique offers different sensitivity levels and throughput capabilities. For kinetic studies, HPLC-based methods provide direct product quantification, while coupled enzyme assays enable real-time monitoring. For structural studies and substrate specificity analysis, LC-MS/MS offers the advantage of product confirmation. Selection should be based on available equipment, required sensitivity, and specific research questions .

How might the crystal structure of Salmonella heidelberg ubiA inform structure-based drug design?

The crystal structure of Salmonella heidelberg ubiA would provide critical insights for structure-based drug design efforts targeting this essential enzyme. While a specific crystal structure for Salmonella heidelberg ubiA is not yet available in public databases, structural insights can be extrapolated from related UbiA superfamily members and used to guide inhibitor development .

Key structural features relevant to drug design include:

  • Substrate binding pockets:

    • The aromatic substrate (PHB) binding site, likely containing polar residues for phenol group interactions

    • The prenyl donor binding site, featuring hydrophobic regions accommodating the isoprenoid chain

    • The catalytic site where C-C bond formation occurs

  • Membrane-embedded regions:

    • Transmembrane helices that could be targeted for disruption of proper membrane integration

    • Lateral access channels for substrate entry from the membrane environment

  • Potential allosteric sites:

    • Regions distal to the active site that could affect enzyme dynamics or substrate binding

A structure-based drug design strategy would involve:

  • Virtual screening campaigns targeting the identified binding pockets

  • Fragment-based approaches to develop small molecules that disrupt enzyme function

  • Molecular dynamics simulations to identify transient binding pockets not evident in static structures

  • Structure-activity relationship studies to optimize lead compounds

Targeting ubiA could be particularly valuable for developing narrow-spectrum antibiotics against Salmonella heidelberg, as inhibition would disrupt energy metabolism while potentially minimizing effects on beneficial microbiota if sufficient structural differences exist between bacterial and host orthologs .

What are the challenges and strategies for studying protein-membrane interactions of recombinant ubiA?

Studying protein-membrane interactions of recombinant ubiA presents several challenges due to its integral membrane nature. These challenges and corresponding strategies include:

  • Challenge: Maintaining native conformation during extraction
    Strategies:

    • Screening multiple detergents (DDM, LMNG, DIBMA) for optimal extraction efficiency and enzyme activity

    • Employing styrene-maleic acid copolymers (SMALPs) to extract the protein with its native lipid environment

    • Using gentle solubilization procedures with detergent:protein ratios carefully optimized

  • Challenge: Reconstituting functional enzyme in artificial membrane systems
    Strategies:

    • Proteoliposome preparation with lipid compositions mimicking bacterial membranes

    • Nanodiscs formation using MSP proteins to create defined membrane patches

    • Controlled detergent removal using Bio-Beads or dialysis with precise removal rates

  • Challenge: Assessing membrane orientation and topological organization
    Strategies:

    • Accessibility assays using membrane-impermeable chemical modifications

    • Limited proteolysis of intact membrane systems versus disrupted membranes

    • Site-directed labeling combined with fluorescence spectroscopy

  • Challenge: Studying dynamic interactions with lipids
    Strategies:

    • Native mass spectrometry to identify tightly bound lipids

    • Hydrogen-deuterium exchange mass spectrometry to map membrane-protected regions

    • Molecular dynamics simulations to predict lipid-protein interactions

  • Challenge: Visualizing membrane integration
    Strategies:

    • Cryo-electron microscopy of the enzyme in nanodiscs

    • Atomic force microscopy of 2D crystals in lipid bilayers

    • Solid-state NMR to determine structural constraints in membrane environment

These methodological approaches enable researchers to overcome the inherent difficulties of studying membrane proteins while gaining insights into how ubiA's membrane environment influences its activity and regulation .

How do mutations in ubiA affect ubiquinone biosynthesis and antimicrobial resistance profiles in Salmonella heidelberg?

The relationship between ubiA mutations, ubiquinone biosynthesis, and antimicrobial resistance in Salmonella heidelberg represents a complex interplay of metabolic and adaptive processes. While specific mutations in Salmonella heidelberg ubiA have not been extensively characterized, existing research on related enzymes suggests several potential impacts:

  • Effects on enzyme kinetics and efficiency:

    • Mutations in substrate binding regions may alter Km values for PHB or prenyl donors

    • Changes in transmembrane domains could affect membrane integration and substrate access

    • Mutations near catalytic residues may reduce catalytic efficiency (kcat)

  • Consequences for ubiquinone biosynthesis:

    • Reduced activity: Decreased ubiquinone levels leading to compromised respiratory capacity

    • Altered substrate specificity: Production of ubiquinone variants with modified chain lengths

    • Complete inactivation: Blockage of ubiquinone synthesis requiring alternative respiratory pathways

  • Impact on antimicrobial resistance:

    • Energy-dependent resistance mechanisms (e.g., efflux pumps) may be compromised with reduced ubiquinone levels

    • Membrane composition changes could alter permeability to antibiotics

    • Metabolic adaptations in response to ubiquinone deficiency might influence stress response pathways

The relationship between ubiA function and antimicrobial resistance may be particularly relevant given that multidrug-resistant Salmonella Heidelberg strains often exhibit resistance to multiple antibiotics, as observed in isolates from swine sources where 73.3% showed resistance to streptomycin, tetracycline, and kanamycin . The presence of Class 1 integrons carrying resistance genes suggests complex resistance mechanisms that may be influenced by cellular energetics dependent on ubiquinone availability .

How should researchers interpret discrepancies in kinetic data between native and recombinant ubiA enzymes?

When confronting discrepancies between kinetic parameters of native and recombinant ubiA enzymes, researchers should systematically evaluate several factors that could explain these differences:

  • Membrane environment differences:

    • Native membranes contain specific lipid compositions that may optimize enzyme function

    • Recombinant systems often use non-native detergents or simplified lipid mixtures

    • Analysis strategy: Compare kinetic parameters across different membrane mimetics (detergents, nanodiscs, proteoliposomes)

  • Post-translational modifications:

    • Native enzymes may harbor modifications absent in recombinant systems

    • Analysis strategy: Use mass spectrometry to identify modifications in native enzyme and introduce them in recombinant systems

  • Protein interaction partners:

    • Native ubiA may function in complex with other proteins in the ubiquinone biosynthetic pathway

    • Analysis strategy: Co-immunoprecipitation studies to identify interaction partners and reconstitution experiments with putative partners

  • Experimental artifacts:

    • Buffer composition effects on enzyme stability and activity

    • Substrate purity and preparation differences

    • Analysis strategy: Standardize buffer conditions and substrate preparations between native and recombinant enzyme assays

  • Data interpretation framework:

ParameterNative EnzymeRecombinant EnzymePossible Explanation for Discrepancy
Km (PHB)Lower valueHigher valueLoss of membrane components that facilitate substrate binding
kcatHigher valueLower valueSuboptimal folding or loss of stabilizing interactions
Substrate specificityBroaderNarrowerMissing cofactors or interaction partners
Temperature stabilityHigherLowerAbsence of stabilizing lipid interactions

This methodical approach allows researchers to determine whether discrepancies represent technical limitations of recombinant systems or reveal genuine insights about the biological context of enzyme function .

How can researchers effectively compare ubiA sequence-structure-function relationships across different bacterial species?

  • Sequence-based analyses:

    • Multiple sequence alignment using structure-aware algorithms (e.g., PROMALS3D)

    • Phylogenetic reconstruction with maximum likelihood or Bayesian methods

    • Identification of conserved motifs using MEME or related tools

    • Analysis of selection pressure using dN/dS ratios to identify sites under positive selection

  • Structure-based comparisons:

    • Homology modeling based on available crystal structures of UbiA superfamily members

    • Superposition of models to identify structural conservation and divergence

    • Mapping of sequence conservation onto structural models

    • Molecular dynamics simulations to compare dynamics in different species orthologs

  • Functional correlation approaches:

    • Statistical coupling analysis to identify co-evolving residues

    • Ancestral sequence reconstruction and resurrection to test evolutionary hypotheses

    • Systematic mutagenesis studies targeting non-conserved regions

    • Substrate docking studies to predict binding mode differences

  • Integrated data visualization:

SpeciesKey Catalytic ResiduesSubstrate SpecificityMembrane Integration FeaturesPredicted Functional Differences
S. heidelbergD191, H126, R137*PHB preferred9 transmembrane segmentsHigher catalytic efficiency
E. coliD191, H126, R137PHB preferred9 transmembrane segmentsLower Km for prenyl donor
M. tuberculosisD192, H127, K138Modified PHB tolerance8 transmembrane segmentsBroader substrate range
P. aeruginosaD190, H125, R136Strict PHB specificity9 transmembrane segmentsHigher temperature stability

*Note: Residue numbering based on S. heidelberg sequence for comparison

  • Experimental validation strategies:

    • Reciprocal mutagenesis to test predicted functional determinants

    • Heterologous expression and complementation in ubiA-deficient strains

    • Chimeric protein construction to map functional domains

    • In vitro enzyme assays with standardized conditions across orthologs

This comprehensive approach allows researchers to establish meaningful evolutionary patterns and predict functional differences based on sequence variations, providing insights into adaptation of ubiquinone biosynthesis across bacterial species .

How might recombinant ubiA studies contribute to understanding Salmonella heidelberg pathogenesis and transmission?

Studies of recombinant ubiA can provide critical insights into Salmonella heidelberg pathogenesis and transmission through several research avenues:

  • Energy metabolism during infection:

    • Ubiquinone biosynthesis is essential for aerobic and anaerobic respiration during host colonization

    • Targeted ubiA gene deletion or modulation could reveal how energy metabolism influences virulence

    • In vivo expression studies could determine if ubiA is differentially regulated during infection

  • Adaptation to host environments:

    • Different host environments (intestinal lumen, macrophages, systemic circulation) present varying oxygen levels and oxidative stress

    • ubiA expression and activity may be modulated to optimize energy production in different niches

    • Recombinant enzyme studies can determine how environmental factors affect enzyme function

  • Survival in food production environments:

    • Salmonella heidelberg is frequently isolated from food animals, particularly poultry and swine

    • ubiA function may contribute to survival in processing environments (temperature stress, disinfectants)

    • Comparative studies between isolates from different sources could reveal adaptive changes

  • Connections to antimicrobial resistance:

    • Salmonella heidelberg isolates from swine demonstrate high rates of multidrug resistance

    • Energy-dependent resistance mechanisms may rely on optimal ubiquinone production

    • Dendrogram analysis has indicated possible clonality between human and swine isolates, suggesting transmission of resistant strains

  • Potential therapeutic targeting:

    • As an essential enzyme, ubiA represents a potential antimicrobial target

    • Structural and functional studies of recombinant enzyme can facilitate inhibitor development

    • Species-specific differences could be exploited for selective targeting

The high prevalence of multidrug resistance in Salmonella heidelberg isolates from food animals (73.3% of swine isolates) underscores the public health significance of this pathogen . Understanding the role of ubiA in pathogen survival and transmission could inform new intervention strategies to reduce foodborne transmission and improve treatment options for resistant infections .

What are the emerging technologies that might advance research on membrane-bound enzymes like ubiA?

Several emerging technologies are poised to revolutionize research on membrane-bound enzymes like ubiA, offering new insights into their structure, dynamics, and function:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy (cryo-EM): Single-particle analysis now achieves near-atomic resolution for membrane proteins without crystallization

    • Micro-electron diffraction (microED): Uses nanocrystals too small for traditional X-ray crystallography

    • Integrative structural biology: Combines multiple experimental techniques (SAXS, HDX-MS, crosslinking) with computational modeling

  • Novel membrane mimetics:

    • Styrene-maleic acid lipid particles (SMALPs): Extract membrane proteins with their native lipid environment

    • Peptidisc technology: Peptide-based membrane mimetics that stabilize membrane proteins

    • Amphipols and nanodiscs with extended stability: Enable longer-term studies and more challenging experiments

  • Single-molecule techniques:

    • Single-molecule FRET: Monitors conformational changes during catalysis

    • Nanopore-based single-molecule detection: Analyzes individual enzyme-substrate interactions

    • High-speed atomic force microscopy: Visualizes enzyme dynamics at the nanoscale

  • Genetic and cellular tools:

    • CRISPR-Cas9 base editing: Precise modification of ubiA without complete gene disruption

    • Optogenetic control of enzyme expression: Spatiotemporal regulation in cellular studies

    • Expanded genetic code: Incorporation of non-canonical amino acids for site-specific probing

  • Computational advances:

    • Enhanced sampling molecular dynamics: Captures rare events in enzyme catalysis

    • Machine learning approaches: Predicts structure-function relationships and guides experimental design

    • Quantum mechanics/molecular mechanics (QM/MM): Models electronic structure of the active site during catalysis

These technologies will enable researchers to address previously intractable questions about ubiA function, including:

  • How substrate and product transit through the membrane-embedded enzyme

  • The role of specific lipids in modulating enzyme activity

  • Conformational changes during the catalytic cycle

  • Interactions with other components of the ubiquinone biosynthetic pathway

The application of these approaches will significantly advance our understanding of this important membrane enzyme family .

What are the major unresolved questions in Salmonella heidelberg ubiA research?

Despite significant advances in understanding UbiA superfamily enzymes, several critical questions remain unresolved specifically for Salmonella heidelberg ubiA:

  • Structure-function relationships:

    • Does the three-dimensional structure of Salmonella heidelberg ubiA possess unique features compared to other bacterial orthologs?

    • How do membrane lipid compositions specific to Salmonella affect enzyme function?

    • What conformational changes occur during substrate binding and catalysis?

  • Regulation mechanisms:

    • How is ubiA expression regulated in response to environmental stressors?

    • Are there post-translational modifications that modulate enzyme activity during infection?

    • Does ubiA interact with other components of the ubiquinone biosynthetic pathway in a multienzyme complex?

  • Role in pathogenesis:

    • How does ubiquinone biosynthesis influence Salmonella heidelberg survival in various host environments?

    • Is there a direct relationship between ubiA function and expression of virulence factors?

    • How does ubiA activity change during different stages of infection?

  • Connection to antimicrobial resistance:

    • Does altered ubiA function contribute to fitness of multidrug-resistant strains?

    • Can targeting ubiA overcome existing resistance mechanisms?

    • Is there co-selection between antimicrobial resistance genes and variants of ubiA?

  • Evolutionary considerations:

    • What selective pressures have shaped the evolution of ubiA in Salmonella heidelberg?

    • Are there horizontal gene transfer events involving ubiA or other ubiquinone biosynthesis genes?

    • Do clinical isolates show evidence of adaptive mutations in ubiA?

Addressing these questions will require multidisciplinary approaches combining structural biology, biochemistry, microbial genetics, and infection models. The public health significance of multidrug-resistant Salmonella heidelberg, particularly in food animals, makes resolving these questions increasingly important .

How should researchers prioritize future studies on Salmonella heidelberg ubiA to maximize public health impact?

To maximize public health impact, future research on Salmonella heidelberg ubiA should be prioritized according to the following framework:

  • Immediate clinical relevance:

    • Characterize ubiA expression in clinical isolates with different antimicrobial resistance profiles

    • Investigate the correlation between ubiquinone metabolism and fitness of multidrug-resistant strains

    • Develop rapid screening assays to identify potential ubiA inhibitors with antimicrobial activity

  • Epidemiological significance:

    • Compare ubiA sequence and expression between isolates from different sources (human, swine, poultry)

    • Determine if specific variants correlate with enhanced transmission or virulence

    • Evaluate whether ubiA function contributes to environmental persistence in food production settings

  • Mechanistic understanding:

    • Resolve the crystal structure of Salmonella heidelberg ubiA

    • Characterize the full kinetic parameters with natural and alternative substrates

    • Identify protein interaction partners that may influence function during infection

  • Therapeutic development:

    • Conduct structure-based virtual screening for potential inhibitors

    • Validate hits in enzyme assays and cellular models

    • Assess combination approaches targeting ubiA and established resistance mechanisms

  • Methodological innovations:

    • Develop improved expression and purification protocols for functional studies

    • Establish reporter systems for monitoring ubiA activity in vivo

    • Create bioinformatic pipelines for analyzing ubiA in metagenomic datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.