Recombinant Salmonella heidelberg ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella heidelberg ATP Synthase Subunit b (atpF)

Recombinant Salmonella heidelberg ATP synthase subunit b (atpF) refers to a synthetically produced version of the atpF protein, which is a subunit of the ATP synthase enzyme found in Salmonella heidelberg . ATP synthase is an essential enzyme complex responsible for producing adenosine triphosphate (ATP), the primary energy currency of cells, through oxidative phosphorylation . The "b" subunit, or atpF, is a component of the F0 sector of the ATP synthase, which is embedded in the cell membrane and facilitates proton transport .

The recombinant form of this protein is typically produced in a host organism such as E. coli, yeast, baculovirus, or mammalian cells, using genetic engineering techniques . The gene encoding the Salmonella heidelberg atpF subunit is inserted into a vector and expressed in the host organism, which then produces the protein . The recombinant protein can then be isolated and purified for various research and industrial applications .

Key Features and Characteristics

FeatureDescription
Source OrganismSalmonella heidelberg
Protein NameATP synthase subunit b (atpF)
SynonymsATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
Gene NameatpF
Recombinant Production HostE. coli, yeast, baculovirus, or mammalian cells
Protein LengthFull Length (1-156 amino acids)
TagN-terminal His tag
Purity>90% as determined by SDS-PAGE
FormLyophilized powder or liquid containing glycerol
StorageStore at -20°C or -80°C, avoid repeated freeze-thaw cycles
ApplicationsSDS-PAGE, vaccine development, immunoassay testing

Applications and Research Findings

  1. Vaccine Development: Recombinant Salmonella proteins, including atpF, are used in vaccine development . Attenuated Salmonella strains can be used as oral delivery systems for recombinant vaccine antigens .

  2. Enzyme-Linked Immunosorbent Assays (ELISAs): Recombinant proteins are utilized in ELISAs to detect and quantify antibodies targeting specific Salmonella antigens .

  3. ATP Synthase Research: The atpF subunit is crucial for understanding the structure and function of ATP synthase . Studies on this subunit can provide insights into the mechanism of ATP synthesis and proton translocation .

  4. Type-III Secretion System (T3SS) Studies: Research indicates that ATP hydrolysis is not always essential for type-III protein secretion in Salmonella . The energy of the proton motive force can compensate for the absence of ATPase activity in certain conditions .

  5. In vitro Diagnostics: Recombinant Salmonella antigen proteins are used for in vitro diagnostics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
atpF; SeHA_C4200; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.