Cardiolipin synthase (cls) catalyzes the transfer of a phosphatidyl group from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), forming diphosphatidylglycerol (CL), a key component of bacterial membranes . In Salmonella heidelberg, clsA is the primary synthase during logarithmic growth, while clsB and clsC may contribute under stress or stationary-phase conditions .
| Parameter | Details |
|---|---|
| Gene Name | clsA (UniProt ID: B4TJM2) |
| Protein Length | 486 amino acids (full-length) |
| Tag | N-terminal His tag (for purification) |
| Expression Host | E. coli |
| Purity | >90% (SDS-PAGE confirmed) |
| Storage Buffer | Tris/PBS-based buffer with 6% trehalose, pH 8.0 |
The recombinant cls protein includes a conserved catalytic domain homologous to phospholipase D (PLD) enzymes, with His217 acting as the active-site nucleophile . Below is a partial sequence highlighting key regions:
Partial AA Sequence (N-terminal region):
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKH...
Cls enzymes, including Salmonella heidelberg clsA, utilize a two-step mechanism:
Phosphodiester Bond Formation: Transfer of a phosphatidyl group from CDP-DAG to PG.
Dephosphorylation: Removal of the cytidylyl group from CDP-DAG to yield CL .
Cardiolipin Synthesis: CL is critical for maintaining membrane curvature and electron transport efficiency .
Antibiotic Resistance: Mutations in cls genes (e.g., in Enterococcus) alter membrane structure, potentially conferring resistance to daptomycin .
Host Interaction: CL modulates host inflammasome activation, though cls deletion in S. Typhimurium did not impair virulence .
Stress Adaptation: clsB and clsC in Salmonella may compensate for clsA loss during stationary phase or osmotic stress .
Enzyme Activity: Recombinant clsA activity is validated via SDS-PAGE and lipid extraction assays .
Structural Insights: Transmembrane helices and PLD-like motifs are conserved, enabling membrane association .
Purity Assurance: >90% purity ensures reliable enzymatic activity .
Stability: Trehalose stabilizes the protein during lyophilization and storage .
| Feature | S. heidelberg clsA | S. Typhimurium clsB/C |
|---|---|---|
| Substrate | PG + CDP-DAG → CL | PG + PE → CL (clsC) or PG + PG → CL |
| Growth Phase Activity | Logarithmic phase | Stationary phase/stress conditions |
| Therapeutic Relevance | Potential target for membrane-targeted drugs | Limited due to functional redundancy |
Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
KEGG: seh:SeHA_C1930
Cardiolipin synthase (CLS) is an essential enzyme involved in the final step of cardiolipin synthesis, catalyzing the transfer of a phosphatidyl residue from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG) . In bacterial systems like Salmonella heidelberg, CLS is crucial for membrane integrity and function. The bacterial-type CLS differs structurally from eukaryotic CLS but performs similar catalytic functions . In Salmonella heidelberg, CLS contributes to membrane stability and may play a role in virulence and antimicrobial resistance, as membrane composition affects drug penetration and cellular responses to environmental stresses . Bacterial CLS functions without requiring the eukaryotic-specific membrane organization systems, making it an interesting target for comparative biochemical studies.
Salmonella heidelberg possesses a bacterial-type cardiolipin synthase that differs significantly from human CLS (hCLS1) in several aspects:
Structural organization: Bacterial CLS typically has fewer transmembrane domains compared to human CLS .
Subcellular localization: Human CLS is specifically localized to mitochondria, while bacterial CLS is distributed in the bacterial membrane .
Substrate specificity: Although both enzymes catalyze similar reactions, bacterial CLS often shows different preferences for acyl chain lengths and saturation in the CDP-DAG substrate .
Genetic organization: The bacterial cls gene is often part of operons related to membrane biogenesis, while hCLS1 is regulated by nuclear factors associated with mitochondrial biogenesis .
Evolutionary origin: Human CLS shares homology with yeast and plant CLS proteins but has evolved distinct regulatory mechanisms .
These differences make the bacterial CLS an attractive target for antimicrobial development, as inhibitors could potentially target bacterial CLS without affecting human CLS function .
Salmonella heidelberg CLS contains several key structural domains critical for its enzymatic function:
Transmembrane domains (TMDs): Bacterial CLS typically contains multiple TMDs that anchor the enzyme in the membrane. Studies with chimeric constructs have demonstrated that the native TMDs are essential for proper enzymatic activity; replacing them with TMDs from other proteins (such as LepB) significantly reduces or abolishes CLS activity .
Catalytic domain: The C-terminal globular domain contains the catalytic site responsible for the condensation reaction between CDP-DAG and PG. This domain must be properly oriented relative to the membrane for effective catalysis .
Substrate binding regions: Specific motifs within the protein structure are responsible for recognizing and positioning the CDP-DAG and PG substrates.
Membrane-association motifs: Beyond the transmembrane domains, specific regions facilitate proper interaction with the phospholipid environment.
Research has shown that the orientation of these domains is crucial - experiments with engineered CLS variants demonstrate that altering the topology of TMDs disrupts the enzyme's ability to synthesize cardiolipin effectively . Additionally, the proper interaction between the TMDs and the catalytic domain appears essential for positioning the active site relative to membrane-embedded substrates.
The effective production of recombinant Salmonella heidelberg CLS requires careful consideration of expression systems. Based on successful approaches with similar membrane proteins:
E. coli-based systems:
BL21(DE3) strains with pET vectors provide strong expression control
C41(DE3) and C43(DE3) strains are specifically optimized for membrane protein expression
Expression at lower temperatures (16-25°C) often improves proper folding
IPTG concentrations should be optimized (typically 0.1-0.5 mM) to prevent toxicity
Cell-free expression systems:
Allow direct incorporation into artificial liposomes
Enable expression of potentially toxic membrane proteins
Provide better control over the lipid environment
Fusion tags:
N-terminal MBP (maltose-binding protein) or SUMO tags improve solubility
C-terminal His6 or Strep tags facilitate purification
TEV or PreScission protease cleavage sites allow tag removal
For functional studies, recombinant CLS can be expressed in COS-7 or similar mammalian cells, similar to the approach used for human CLS . This allows assessment of enzymatic activity both in vitro and in intact cells. For structural studies, insect cell expression using baculovirus vectors may provide higher yields of properly folded protein.
When designing constructs, care must be taken to preserve the native TMD organization, as this is critical for enzyme function, as demonstrated in studies of similar CLS proteins .
Several robust assays can be employed to measure Salmonella heidelberg CLS activity in vitro:
Radiometric assay:
Reaction mixture (200 μl): 50 mM Tris/HCl (pH 8.0), 4.0 mM MgCl₂, 20 μM [¹⁴C]oleoyl-CoA (50 mCi/mmol), 2.0 mM LPG, and 2.0 mM CDP-DAG
Initiate reaction with 50 μg protein (cell homogenate or purified enzyme)
Incubate for 20 min at 30°C
Extract lipids and separate by thin-layer chromatography
Fluorescence-based assay:
Use fluorescently-labeled CDP-DAG analogs
Monitor reaction progress in real-time by changes in fluorescence properties
Allows continuous measurement without sample processing
Mass spectrometry-based assay:
Reaction mixture with non-labeled substrates
Quench at various time points
Analyze product formation by LC-MS/MS
Provides detailed information about product structure
Coupled enzyme assay:
Link CLS activity to consumption or production of a chromogenic/fluorogenic compound
Monitor spectrophotometrically in real-time
Useful for high-throughput screening
For all assays, proper controls are essential:
Heat-inactivated enzyme controls
Reactions without individual substrates
Reactions with known CLS inhibitors
When characterizing recombinant CLS, it's recommended to assess both substrate specificity (varying CDP-DAG and PG species) and reaction conditions (pH, temperature, divalent cation requirements). Enzyme kinetics (Km, Vmax) should be determined for key substrates to facilitate comparisons with CLS from other organisms .
Purifying recombinant Salmonella heidelberg CLS requires specialized approaches due to its membrane-associated nature. A reliable protocol would include:
Expression optimization:
Use E. coli C41(DE3) or C43(DE3) strains
Express at 20°C with 0.2 mM IPTG induction
Include 5% glycerol in growth media to stabilize membranes
Membrane isolation:
Harvest cells and disrupt by sonication or cell disruption
Remove unbroken cells and debris (1,000×g, 15 min)
Collect membranes by ultracentrifugation (100,000×g, 1 hour)
Wash membrane pellet to remove peripheral proteins
Solubilization:
Resuspend membranes in buffer with 50 mM Tris-HCl pH 7.5, 300 mM NaCl
Add detergent carefully (recommended options):
n-Dodecyl-β-D-maltoside (DDM) at 1-2%
Lauryl maltose neopentyl glycol (LMNG) at 1%
Digitonin at 1-2% for milder extraction
Incubate with gentle stirring at 4°C for 2 hours
Ultracentrifuge (100,000×g, 45 min) to remove insoluble material
Affinity chromatography:
Apply solubilized protein to Ni-NTA (for His-tagged CLS)
Use extended washing with lower imidazole (20-40 mM) to reduce non-specific binding
Elute with imidazole gradient (50-500 mM)
Maintain detergent at CMC concentration in all buffers
Size exclusion chromatography:
Apply pooled affinity fractions to Superdex 200
Use buffer with reduced detergent concentration
Collect fractions containing monomeric/oligomeric CLS
Stability considerations:
Add 10-20% glycerol to final preparation
Include phospholipids (0.1-0.5 mg/ml) to stabilize
Store at -80°C in small aliquots
Avoid repeated freeze-thaw cycles
The purified enzyme can be validated by testing its enzymatic activity using the in vitro assays described earlier. Western blotting with antibodies specific to CLS or to the affinity tag can confirm protein identity. Additionally, mass spectrometry analysis of tryptic peptides can verify protein sequence and detect any post-translational modifications .
Cardiolipin synthase plays several important roles in antimicrobial resistance in Salmonella heidelberg through multiple mechanisms:
Membrane permeability modulation:
Stress response integration:
Plasmid stability:
Virulence-resistance coupling:
While direct genetic modifications of Salmonella heidelberg CLS have not been extensively characterized in the provided search results, several important genetic modifications can be inferred from related research:
Expression level alterations:
Upregulation of cls gene expression has been observed in some resistant isolates
Promoter mutations that increase CLS expression could enhance resistance by altering membrane composition
Conversely, experimental downregulation of CLS might increase susceptibility to certain antibiotics
Genetic variations in cls sequence:
Point mutations affecting substrate binding may alter cardiolipin composition
Variations in transmembrane domains could affect enzyme localization and function
Such mutations might arise under selective pressure from antimicrobials
Horizontal gene transfer:
Regulatory network changes:
Mutations in regulators that control cls expression
Altered stress response pathways that modulate cardiolipin synthesis
Cross-talk between resistance mechanisms and membrane adaptation pathways
The phenotypic impact of these modifications would include:
Altered membrane permeability to antimicrobials
Changes in protein-membrane interactions affecting drug efflux systems
Modified stress response efficacy under antimicrobial pressure
Of particular interest is the presence of novel resistance patterns in Salmonella Heidelberg isolates, which demonstrate nonsusceptibility to up to 11 of 14 antimicrobial agents tested, suggesting complex adaptations that may involve membrane modifications alongside specific resistance genes . Further research specifically targeting cls gene modifications in these isolates would help clarify its direct contribution to resistance phenotypes.
Cardiolipin plays several crucial roles in Salmonella heidelberg virulence and pathogenesis, highlighting the importance of CLS in bacterial pathophysiology:
Membrane microdomain organization:
Cardiolipin forms specialized membrane domains that serve as platforms for virulence factors
These domains may concentrate proteins involved in host-pathogen interactions
Proper localization of secretion systems depends on membrane lipid composition
Stress resistance during infection:
Cardiolipin enhances bacterial survival under host-imposed stresses:
Acid stress (stomach, phagosome)
Osmotic stress (intestinal environment)
Oxidative stress (macrophage oxidative burst)
This stress resistance is particularly important for Salmonella's intracellular lifestyle
Support for virulence-associated genetic elements:
Energy metabolism during infection:
Cardiolipin stabilizes respiratory complexes
Ensures efficient energy production during different infection stages
Supports ATP generation needed for virulence factor expression and function
Biofilm formation:
Cardiolipin influences bacterial surface properties
May enhance biofilm formation and persistence
Contributes to chronic infection and transmission
The connection between virulence and antimicrobial resistance in Salmonella Heidelberg is particularly notable. Research has demonstrated that resistance has been associated with elevated virulence, possibly due to coselection of virulence traits with resistance mechanisms . MDR Salmonella Heidelberg strains show high hospitalization rates (35%), similar to previous outbreaks, suggesting enhanced clinical severity . The presence of specific virulence factors like the safABCD operon in resistant isolates highlights the complex interplay between resistance, membrane composition, and virulence capability.
Salmonella heidelberg cardiolipin synthase exhibits both conserved features and distinctive characteristics when compared to CLS from other bacterial pathogens:
Structural conservation:
The basic catalytic mechanism is conserved across bacterial species
Core functional domains show high sequence similarity, particularly in the catalytic region
Transmembrane organization follows similar patterns across Gram-negative bacteria
Bacterial pathogen-specific adaptations:
*While T. brucei is not a bacterial pathogen, it possesses a bacterial-type CLS that provides an interesting evolutionary comparison
Substrate specificity differences:
Variation in preferred acyl chain length and saturation in CDP-DAG substrates
Different PG substrate requirements across species
These differences may reflect adaptation to specific host environments or growth conditions
Regulatory network variations:
CLS expression is regulated differently across pathogens
Integration with stress response systems shows species-specific patterns
Some pathogens modulate CLS activity in response to host environments
The bacterial-type CLS found in T. brucei provides an interesting evolutionary comparison, as it represents a prokaryotic-type enzyme operating in a eukaryotic organism. Studies have shown that this enzyme is essential for parasite viability, with its depletion causing alterations in mitochondrial morphology and function . This parallels the importance of CLS in bacterial pathogens like Salmonella heidelberg, suggesting evolutionary conservation of function despite divergence in other aspects of cellular biology.
Studying Salmonella heidelberg CLS provides valuable evolutionary insights into bacterial adaptation and pathogen evolution:
Evolutionary conservation of membrane biosynthesis:
CLS represents an ancient and conserved pathway for membrane phospholipid synthesis
The basic catalytic mechanism has been maintained across diverse bacterial lineages
This conservation highlights the fundamental importance of cardiolipin in bacterial physiology
Horizontal gene transfer and resistance evolution:
Salmonella Heidelberg strains have horizontally acquired resistance to multiple antimicrobials
These resistant lineages show distinct geographical distribution patterns
Genomic analyses reveal both chromosomal integration and plasmid-borne resistance genes
The membrane environment, influenced by CLS activity, may affect the success of horizontal gene transfer
Paralog evolution and specialization:
Serovar-specific adaptations:
Lipid metabolism as an evolutionary driver:
Changes in membrane composition can affect multiple aspects of bacterial physiology
Selection pressure on membrane properties may drive the evolution of enzymes like CLS
The co-evolution of membranes with cellular systems provides insight into bacterial adaptation
Genomic studies of global Salmonella isolates reveal that serovars like Concord (with similar evolutionary considerations to Heidelberg) are polyphyletic and distributed among multiple lineages with varying resistance profiles . This suggests that membrane adaptation through enzymes like CLS may have occurred independently in different lineages, potentially leading to convergent phenotypes optimized for specific environmental challenges.
The evolution of CLS function across different Salmonella serovars reflects adaptation to diverse ecological niches and host environments:
Conservation of core function with serovar-specific tuning:
The fundamental cardiolipin synthesis mechanism is preserved across all Salmonella serovars
Fine-tuning of enzyme properties may occur through subtle sequence variations
These adaptations optimize membrane composition for specific host environments
Differential expression regulation:
Various Salmonella serovars show distinct patterns of CLS expression
Host-adapted serovars may have evolved specialized regulatory mechanisms
Environmental signals triggering CLS upregulation likely differ between serovars
Co-evolution with resistance mechanisms:
Adaptation to host range:
Host-restricted serovars show different membrane adaptation strategies compared to broad-host-range serovars
Salmonella Heidelberg's membrane adaptations may contribute to its success in various hosts
Changes in cardiolipin content and distribution likely reflect host-specific challenges
Integration with virulence systems:
Comparative genomic analyses reveal that Salmonella serovars like Concord (with similar evolutionary considerations to Heidelberg) are distributed among multiple lineages, suggesting independent evolution of membrane adaptation strategies . Some lineages show restricted geographical distribution and high levels of antimicrobial resistance, while others are more widely distributed with lower resistance levels. This pattern suggests that CLS function may have evolved differently in these lineages, potentially influenced by local antimicrobial use practices and transmission patterns.
The development of CLS inhibitors as antimicrobials against Salmonella heidelberg offers several promising research directions:
Structure-based drug design:
Determination of Salmonella heidelberg CLS crystal structure
Identification of druggable pockets within the catalytic domain
Computational screening of compound libraries against these sites
Optimization of lead compounds through medicinal chemistry approaches
Substrate analog development:
Design of non-hydrolyzable CDP-DAG analogs
Phosphonate-based PG mimetics that bind but prevent catalysis
Lipid-based inhibitors with enhanced membrane penetration
Targeting unique bacterial CLS features:
Allosteric inhibition strategies:
Identification of regulatory sites outside the catalytic domain
Screening for compounds that lock CLS in inactive conformations
Peptide-based inhibitors targeting protein-protein interaction sites
Combination approaches:
CLS inhibitors combined with existing antibiotics
Targeting multiple enzymes in the cardiolipin synthesis pathway
Membrane-disrupting agents that synergize with CLS inhibition
Such inhibitors could be particularly effective against MDR Salmonella Heidelberg strains, which already demonstrate resistance to multiple antibiotic classes . The high hospitalization rate associated with these strains (35%) underscores the need for novel therapeutic approaches . By targeting CLS, which affects fundamental membrane properties, these inhibitors might overcome existing resistance mechanisms and provide new options for treatment of severe infections.
Genetic engineering of Salmonella heidelberg CLS offers diverse opportunities for both fundamental research and biotechnological applications:
Fundamental research applications:
Creation of conditional CLS knockouts to study essentiality under various conditions
Site-directed mutagenesis to identify critical residues for catalysis and substrate binding
Domain swapping with CLS from other organisms to understand functional evolution
Engineering reporter fusions to monitor CLS expression and localization in real-time
CRISPR-based CLS regulation to study membrane adaptation dynamics
Biotechnological applications:
Vaccine development:
Attenuated Salmonella strains with modified CLS as live vaccines
Engineered membrane composition to enhance immunogenicity
Controlled membrane properties to improve vaccine stability
Bioproduction platforms:
Engineered Salmonella with modified membranes for recombinant protein production
Optimized cardiolipin content to enhance secretion system efficiency
Strains with increased membrane stability for industrial processes
Diagnostic tools:
Engineered reporter strains to detect CLS inhibitors
Biosensors based on CLS activity for antimicrobial discovery
Systems to identify compounds that affect membrane integrity
Structural biology advances:
Expression systems for producing modified CLS variants
Engineering stabilized CLS for crystallography studies
Creation of minimal CLS constructs for NMR structural analysis
Synthetic biology approaches:
Redesign of CLS to accept non-natural substrates
Engineering synthetic cardiolipin variants with novel properties
Creation of orthogonal membrane systems in bacterial cells
The experiences with chimeric constructs containing transmembrane domains from different proteins provide valuable insights for these engineering approaches. Research has shown that swapping TMDs (as in LepB+0 constructs) significantly affects CLS activity, highlighting the importance of domain organization for function . These findings can guide rational engineering of CLS variants with desired properties for research and biotechnological applications.
Studying recombinant Salmonella heidelberg CLS presents several technical challenges that require innovative solutions:
Expression and purification challenges:
Challenge: Membrane proteins like CLS are difficult to express in functional form
Solutions:
Use specialized expression strains (C41/C43)
Employ fusion partners that enhance folding and solubility
Explore cell-free expression systems with defined membrane mimetics
Develop mild solubilization protocols using newer detergents (LMNG, GDN)
Structural characterization limitations:
Challenge: Obtaining high-resolution structural data for membrane proteins
Solutions:
Apply cryo-EM for structure determination without crystallization
Use hydrogen-deuterium exchange mass spectrometry for dynamics
Implement solid-state NMR approaches for membrane-embedded CLS
Develop computational models validated by cross-linking data
Functional assay constraints:
Challenge: Current assays often require radioactive materials or complex setups
Solutions:
Develop fluorescence-based continuous assays
Create high-throughput screening platforms
Implement label-free detection methods (mass spectrometry, NMR)
Design biosensor systems for in vivo activity monitoring
In vivo relevance issues:
Challenge: Connecting in vitro findings to in vivo function
Solutions:
Develop conditional expression systems in Salmonella
Create reporter strains that monitor cardiolipin levels
Implement metabolic labeling approaches for in vivo tracking
Use advanced imaging techniques for cardiolipin visualization
Heterogeneity problems:
Challenge: Natural variation in lipid composition affects reproducibility
Solutions:
Define synthetic minimal lipid environments
Standardize growth conditions to normalize membrane composition
Implement single-molecule approaches to account for heterogeneity
Develop computational models that incorporate composition variables
Research has shown that proper orientation of transmembrane domains is critical for CLS function, as demonstrated in engineered constructs with altered TMD arrangements . This suggests that maintaining native-like membrane environments during recombinant expression and analysis is crucial. Similarly, studies with human CLS expressed in COS-7 cells demonstrated that cellular context affects enzyme function, highlighting the importance of appropriate expression systems .
Combining these approaches with advanced genetic tools for Salmonella manipulation would enable more comprehensive study of CLS function in both fundamental research and applications for antimicrobial development against multidrug-resistant strains .
Despite progress in understanding cardiolipin synthase in various organisms, several critical questions about Salmonella heidelberg CLS remain unresolved:
Structure-function relationships:
What is the high-resolution structure of Salmonella heidelberg CLS?
How does the enzyme's structure change during the catalytic cycle?
Which specific residues are essential for substrate recognition and catalysis?
How do transmembrane domains influence the positioning of the catalytic domain?
Regulation mechanisms:
How is CLS expression regulated during infection and stress responses?
What environmental signals modulate CLS activity in vivo?
Are there post-translational modifications that affect enzyme function?
How is cardiolipin synthesis coordinated with other membrane biosynthesis pathways?
Role in antimicrobial resistance:
What is the direct contribution of CLS to the MDR phenotype in Salmonella Heidelberg?
How does cardiolipin distribution affect the function of resistance proteins?
Can modulation of CLS activity restore sensitivity to antibiotics?
Is there correlation between CLS sequence variants and resistance profiles?
Virulence connections:
How does cardiolipin distribution affect the localization and function of virulence factors?
Does CLS activity change during different stages of infection?
Is there direct interaction between CLS and components of virulence systems?
How does the safABCD operon (found in virulent strains) interact with membrane systems?
Evolutionary aspects:
Addressing these questions will require integrative approaches combining structural biology, genetic engineering, advanced imaging, and infection models. The complex relationship between membrane composition, resistance, and virulence in Salmonella Heidelberg makes this a particularly rich area for investigation with implications for both fundamental understanding and therapeutic development.
Advances in synthetic biology and protein engineering offer transformative approaches for studying and utilizing Salmonella heidelberg CLS:
These approaches would significantly enhance our understanding of the fundamental role of CLS in Salmonella physiology and pathogenesis. Research has already demonstrated the importance of transmembrane domain organization for CLS function , and protein engineering approaches could further explore this relationship. Similarly, studies with human CLS have shown the feasibility of recombinant expression and functional characterization , providing a foundation for more advanced synthetic biology applications with bacterial CLS.
The high prevalence of multidrug resistance in Salmonella Heidelberg makes this an important system for developing new approaches to overcome antimicrobial resistance, potentially through targeting membrane biosynthesis pathways or using engineered CLS variants as components of novel therapeutic strategies.
Research on Salmonella heidelberg CLS provides valuable insights that could inform broader strategies for addressing global antimicrobial resistance challenges:
Membrane-targeted therapeutic approaches:
CLS research highlights the critical role of membrane composition in bacterial physiology
Targeting membrane biosynthesis represents an underexplored strategy for antimicrobial development
Combination therapies that disrupt membrane homeostasis may overcome existing resistance mechanisms
Such approaches could be effective against diverse pathogens beyond Salmonella
One Health implications:
Salmonella Heidelberg outbreaks demonstrate the interconnection between animal and human health
CLS-related membrane adaptations likely play roles in both host environments
Understanding these adaptations can inform agricultural and clinical antimicrobial use policies
Integrated surveillance of membrane-related resistance mechanisms could provide early warnings
Novel diagnostic strategies:
Membrane composition changes associated with resistance could serve as diagnostic biomarkers
Rapid tests detecting CLS activity or cardiolipin levels might predict treatment outcomes
These approaches could enable more targeted antimicrobial therapy
Point-of-care diagnostics based on these principles could improve stewardship globally
Basic research translation:
Fundamental studies of bacterial membrane biology reveal potential intervention points
Evolutionary analysis of CLS across pathogens identifies conserved vulnerabilities
Structural studies can guide rational drug design targeting essential membrane processes
Understanding resistance-virulence connections informs risk assessment of emerging strains
Alternative strategies to antibiotics:
CLS-based membrane engineering might create effective live attenuated vaccines
Biological control strategies targeting membrane integrity could replace conventional antibiotics
Phage therapy approaches could be enhanced by understanding membrane adaptation mechanisms
Anti-virulence strategies might be developed by disrupting membrane domain organization
The prevalence of MDR in Salmonella has increased over time, making severe infections increasingly difficult to treat with empirical antimicrobial therapy . Research on Salmonella Heidelberg has revealed complex resistance profiles with nonsusceptibility to up to 11 antimicrobial agents, highlighting the urgency of developing alternative approaches . Global genomic analysis of related Salmonella serovars demonstrates the worldwide spread of resistant lineages, underscoring the need for coordinated international responses .
By applying lessons from CLS research to the broader challenge of antimicrobial resistance, we may identify novel intervention points and develop strategies that remain effective despite the continued evolution of resistance mechanisms.