Recombinant Salmonella heidelberg Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Role

Cardiolipin synthase (cls) catalyzes the transfer of a phosphatidyl group from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), forming diphosphatidylglycerol (CL), a key component of bacterial membranes . In Salmonella heidelberg, clsA is the primary synthase during logarithmic growth, while clsB and clsC may contribute under stress or stationary-phase conditions .

Key Features of Recombinant Salmonella heidelberg cls:

ParameterDetails
Gene NameclsA (UniProt ID: B4TJM2)
Protein Length486 amino acids (full-length)
TagN-terminal His tag (for purification)
Expression HostE. coli
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

Amino Acid Sequence

The recombinant cls protein includes a conserved catalytic domain homologous to phospholipase D (PLD) enzymes, with His217 acting as the active-site nucleophile . Below is a partial sequence highlighting key regions:

Partial AA Sequence (N-terminal region):
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKH...

Catalytic Mechanism

Cls enzymes, including Salmonella heidelberg clsA, utilize a two-step mechanism:

  1. Phosphodiester Bond Formation: Transfer of a phosphatidyl group from CDP-DAG to PG.

  2. Dephosphorylation: Removal of the cytidylyl group from CDP-DAG to yield CL .

Role in Membrane Homeostasis

  • Cardiolipin Synthesis: CL is critical for maintaining membrane curvature and electron transport efficiency .

  • Antibiotic Resistance: Mutations in cls genes (e.g., in Enterococcus) alter membrane structure, potentially conferring resistance to daptomycin .

Virulence and Pathogenesis

  • Host Interaction: CL modulates host inflammasome activation, though cls deletion in S. Typhimurium did not impair virulence .

  • Stress Adaptation: clsB and clsC in Salmonella may compensate for clsA loss during stationary phase or osmotic stress .

Biochemical Studies

  • Enzyme Activity: Recombinant clsA activity is validated via SDS-PAGE and lipid extraction assays .

  • Structural Insights: Transmembrane helices and PLD-like motifs are conserved, enabling membrane association .

Key Considerations

  • Purity Assurance: >90% purity ensures reliable enzymatic activity .

  • Stability: Trehalose stabilizes the protein during lyophilization and storage .

Comparative Analysis with Other cls Enzymes

FeatureS. heidelberg clsAS. Typhimurium clsB/C
SubstratePG + CDP-DAG → CLPG + PE → CL (clsC) or PG + PG → CL
Growth Phase ActivityLogarithmic phaseStationary phase/stress conditions
Therapeutic RelevancePotential target for membrane-targeted drugsLimited due to functional redundancy

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; SeHA_C1930; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what role does it play in Salmonella heidelberg?

Cardiolipin synthase (CLS) is an essential enzyme involved in the final step of cardiolipin synthesis, catalyzing the transfer of a phosphatidyl residue from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG) . In bacterial systems like Salmonella heidelberg, CLS is crucial for membrane integrity and function. The bacterial-type CLS differs structurally from eukaryotic CLS but performs similar catalytic functions . In Salmonella heidelberg, CLS contributes to membrane stability and may play a role in virulence and antimicrobial resistance, as membrane composition affects drug penetration and cellular responses to environmental stresses . Bacterial CLS functions without requiring the eukaryotic-specific membrane organization systems, making it an interesting target for comparative biochemical studies.

How does Salmonella heidelberg CLS differ from human cardiolipin synthase?

Salmonella heidelberg possesses a bacterial-type cardiolipin synthase that differs significantly from human CLS (hCLS1) in several aspects:

  • Structural organization: Bacterial CLS typically has fewer transmembrane domains compared to human CLS .

  • Subcellular localization: Human CLS is specifically localized to mitochondria, while bacterial CLS is distributed in the bacterial membrane .

  • Substrate specificity: Although both enzymes catalyze similar reactions, bacterial CLS often shows different preferences for acyl chain lengths and saturation in the CDP-DAG substrate .

  • Genetic organization: The bacterial cls gene is often part of operons related to membrane biogenesis, while hCLS1 is regulated by nuclear factors associated with mitochondrial biogenesis .

  • Evolutionary origin: Human CLS shares homology with yeast and plant CLS proteins but has evolved distinct regulatory mechanisms .

These differences make the bacterial CLS an attractive target for antimicrobial development, as inhibitors could potentially target bacterial CLS without affecting human CLS function .

What are the key structural domains of Salmonella heidelberg CLS that are critical for function?

Salmonella heidelberg CLS contains several key structural domains critical for its enzymatic function:

  • Transmembrane domains (TMDs): Bacterial CLS typically contains multiple TMDs that anchor the enzyme in the membrane. Studies with chimeric constructs have demonstrated that the native TMDs are essential for proper enzymatic activity; replacing them with TMDs from other proteins (such as LepB) significantly reduces or abolishes CLS activity .

  • Catalytic domain: The C-terminal globular domain contains the catalytic site responsible for the condensation reaction between CDP-DAG and PG. This domain must be properly oriented relative to the membrane for effective catalysis .

  • Substrate binding regions: Specific motifs within the protein structure are responsible for recognizing and positioning the CDP-DAG and PG substrates.

  • Membrane-association motifs: Beyond the transmembrane domains, specific regions facilitate proper interaction with the phospholipid environment.

Research has shown that the orientation of these domains is crucial - experiments with engineered CLS variants demonstrate that altering the topology of TMDs disrupts the enzyme's ability to synthesize cardiolipin effectively . Additionally, the proper interaction between the TMDs and the catalytic domain appears essential for positioning the active site relative to membrane-embedded substrates.

What are the most effective expression systems for producing recombinant Salmonella heidelberg CLS?

The effective production of recombinant Salmonella heidelberg CLS requires careful consideration of expression systems. Based on successful approaches with similar membrane proteins:

  • E. coli-based systems:

    • BL21(DE3) strains with pET vectors provide strong expression control

    • C41(DE3) and C43(DE3) strains are specifically optimized for membrane protein expression

    • Expression at lower temperatures (16-25°C) often improves proper folding

    • IPTG concentrations should be optimized (typically 0.1-0.5 mM) to prevent toxicity

  • Cell-free expression systems:

    • Allow direct incorporation into artificial liposomes

    • Enable expression of potentially toxic membrane proteins

    • Provide better control over the lipid environment

  • Fusion tags:

    • N-terminal MBP (maltose-binding protein) or SUMO tags improve solubility

    • C-terminal His6 or Strep tags facilitate purification

    • TEV or PreScission protease cleavage sites allow tag removal

For functional studies, recombinant CLS can be expressed in COS-7 or similar mammalian cells, similar to the approach used for human CLS . This allows assessment of enzymatic activity both in vitro and in intact cells. For structural studies, insect cell expression using baculovirus vectors may provide higher yields of properly folded protein.

When designing constructs, care must be taken to preserve the native TMD organization, as this is critical for enzyme function, as demonstrated in studies of similar CLS proteins .

What are the recommended assays for measuring Salmonella heidelberg CLS activity in vitro?

Several robust assays can be employed to measure Salmonella heidelberg CLS activity in vitro:

  • Radiometric assay:

    • Reaction mixture (200 μl): 50 mM Tris/HCl (pH 8.0), 4.0 mM MgCl₂, 20 μM [¹⁴C]oleoyl-CoA (50 mCi/mmol), 2.0 mM LPG, and 2.0 mM CDP-DAG

    • Initiate reaction with 50 μg protein (cell homogenate or purified enzyme)

    • Incubate for 20 min at 30°C

    • Extract lipids and separate by thin-layer chromatography

    • Quantify radioactive cardiolipin by scintillation counting

  • Fluorescence-based assay:

    • Use fluorescently-labeled CDP-DAG analogs

    • Monitor reaction progress in real-time by changes in fluorescence properties

    • Allows continuous measurement without sample processing

  • Mass spectrometry-based assay:

    • Reaction mixture with non-labeled substrates

    • Quench at various time points

    • Analyze product formation by LC-MS/MS

    • Provides detailed information about product structure

  • Coupled enzyme assay:

    • Link CLS activity to consumption or production of a chromogenic/fluorogenic compound

    • Monitor spectrophotometrically in real-time

    • Useful for high-throughput screening

For all assays, proper controls are essential:

  • Heat-inactivated enzyme controls

  • Reactions without individual substrates

  • Reactions with known CLS inhibitors

When characterizing recombinant CLS, it's recommended to assess both substrate specificity (varying CDP-DAG and PG species) and reaction conditions (pH, temperature, divalent cation requirements). Enzyme kinetics (Km, Vmax) should be determined for key substrates to facilitate comparisons with CLS from other organisms .

How can I establish a reliable purification protocol for recombinant Salmonella heidelberg CLS?

Purifying recombinant Salmonella heidelberg CLS requires specialized approaches due to its membrane-associated nature. A reliable protocol would include:

  • Expression optimization:

    • Use E. coli C41(DE3) or C43(DE3) strains

    • Express at 20°C with 0.2 mM IPTG induction

    • Include 5% glycerol in growth media to stabilize membranes

  • Membrane isolation:

    • Harvest cells and disrupt by sonication or cell disruption

    • Remove unbroken cells and debris (1,000×g, 15 min)

    • Collect membranes by ultracentrifugation (100,000×g, 1 hour)

    • Wash membrane pellet to remove peripheral proteins

  • Solubilization:

    • Resuspend membranes in buffer with 50 mM Tris-HCl pH 7.5, 300 mM NaCl

    • Add detergent carefully (recommended options):

      • n-Dodecyl-β-D-maltoside (DDM) at 1-2%

      • Lauryl maltose neopentyl glycol (LMNG) at 1%

      • Digitonin at 1-2% for milder extraction

    • Incubate with gentle stirring at 4°C for 2 hours

    • Ultracentrifuge (100,000×g, 45 min) to remove insoluble material

  • Affinity chromatography:

    • Apply solubilized protein to Ni-NTA (for His-tagged CLS)

    • Use extended washing with lower imidazole (20-40 mM) to reduce non-specific binding

    • Elute with imidazole gradient (50-500 mM)

    • Maintain detergent at CMC concentration in all buffers

  • Size exclusion chromatography:

    • Apply pooled affinity fractions to Superdex 200

    • Use buffer with reduced detergent concentration

    • Collect fractions containing monomeric/oligomeric CLS

  • Stability considerations:

    • Add 10-20% glycerol to final preparation

    • Include phospholipids (0.1-0.5 mg/ml) to stabilize

    • Store at -80°C in small aliquots

    • Avoid repeated freeze-thaw cycles

The purified enzyme can be validated by testing its enzymatic activity using the in vitro assays described earlier. Western blotting with antibodies specific to CLS or to the affinity tag can confirm protein identity. Additionally, mass spectrometry analysis of tryptic peptides can verify protein sequence and detect any post-translational modifications .

How does cardiolipin synthase contribute to antimicrobial resistance in Salmonella heidelberg?

Cardiolipin synthase plays several important roles in antimicrobial resistance in Salmonella heidelberg through multiple mechanisms:

  • Membrane permeability modulation:

    • Cardiolipin alters membrane fluidity and permeability, potentially reducing drug penetration

    • The unique structure of cardiolipin creates microdomains that may exclude certain antimicrobials

    • Changes in cardiolipin content can affect the proton gradient necessary for the function of many antibiotics

  • Stress response integration:

    • Cardiolipin-rich domains stabilize essential membrane proteins during stress

    • Under antibiotic pressure, increased cardiolipin production may help maintain membrane integrity

    • These adaptations may be particularly important in multidrug-resistant (MDR) strains

  • Plasmid stability:

    • MDR Salmonella Heidelberg isolates often contain IncC plasmids carrying resistance genes

    • Proper cardiolipin distribution may support plasmid maintenance and replication

    • This connection is supported by observations that MDR strains often show altered membrane composition

  • Virulence-resistance coupling:

    • Resistance has been associated with elevated virulence in Salmonella Heidelberg

    • This may involve coselection of virulence traits with resistance mechanisms

    • Cardiolipin domains could serve as platforms for both virulence factors and resistance proteins

What genetic modifications of Salmonella heidelberg CLS have been associated with changes in antimicrobial susceptibility?

While direct genetic modifications of Salmonella heidelberg CLS have not been extensively characterized in the provided search results, several important genetic modifications can be inferred from related research:

  • Expression level alterations:

    • Upregulation of cls gene expression has been observed in some resistant isolates

    • Promoter mutations that increase CLS expression could enhance resistance by altering membrane composition

    • Conversely, experimental downregulation of CLS might increase susceptibility to certain antibiotics

  • Genetic variations in cls sequence:

    • Point mutations affecting substrate binding may alter cardiolipin composition

    • Variations in transmembrane domains could affect enzyme localization and function

    • Such mutations might arise under selective pressure from antimicrobials

  • Horizontal gene transfer:

    • Salmonella Heidelberg can acquire resistance through horizontal gene transfer

    • MDR strains often contain plasmids (IncC, IncHI2) carrying multiple resistance genes

    • The stability and expression of these plasmids may be influenced by membrane composition

  • Regulatory network changes:

    • Mutations in regulators that control cls expression

    • Altered stress response pathways that modulate cardiolipin synthesis

    • Cross-talk between resistance mechanisms and membrane adaptation pathways

The phenotypic impact of these modifications would include:

  • Altered membrane permeability to antimicrobials

  • Changes in protein-membrane interactions affecting drug efflux systems

  • Modified stress response efficacy under antimicrobial pressure

Of particular interest is the presence of novel resistance patterns in Salmonella Heidelberg isolates, which demonstrate nonsusceptibility to up to 11 of 14 antimicrobial agents tested, suggesting complex adaptations that may involve membrane modifications alongside specific resistance genes . Further research specifically targeting cls gene modifications in these isolates would help clarify its direct contribution to resistance phenotypes.

What role does cardiolipin play in Salmonella heidelberg virulence and pathogenesis?

Cardiolipin plays several crucial roles in Salmonella heidelberg virulence and pathogenesis, highlighting the importance of CLS in bacterial pathophysiology:

  • Membrane microdomain organization:

    • Cardiolipin forms specialized membrane domains that serve as platforms for virulence factors

    • These domains may concentrate proteins involved in host-pathogen interactions

    • Proper localization of secretion systems depends on membrane lipid composition

  • Stress resistance during infection:

    • Cardiolipin enhances bacterial survival under host-imposed stresses:

      • Acid stress (stomach, phagosome)

      • Osmotic stress (intestinal environment)

      • Oxidative stress (macrophage oxidative burst)

    • This stress resistance is particularly important for Salmonella's intracellular lifestyle

  • Support for virulence-associated genetic elements:

    • Genomic analysis of virulent Salmonella Heidelberg isolates identified specific virulence factors:

      • The safABCD genetic operon encoding adhesive fimbriae

      • These fimbriae confer enhanced pathogenesis

      • This operon is uncommon in Salmonella Heidelberg, suggesting recent acquisition

  • Energy metabolism during infection:

    • Cardiolipin stabilizes respiratory complexes

    • Ensures efficient energy production during different infection stages

    • Supports ATP generation needed for virulence factor expression and function

  • Biofilm formation:

    • Cardiolipin influences bacterial surface properties

    • May enhance biofilm formation and persistence

    • Contributes to chronic infection and transmission

The connection between virulence and antimicrobial resistance in Salmonella Heidelberg is particularly notable. Research has demonstrated that resistance has been associated with elevated virulence, possibly due to coselection of virulence traits with resistance mechanisms . MDR Salmonella Heidelberg strains show high hospitalization rates (35%), similar to previous outbreaks, suggesting enhanced clinical severity . The presence of specific virulence factors like the safABCD operon in resistant isolates highlights the complex interplay between resistance, membrane composition, and virulence capability.

How does Salmonella heidelberg CLS compare to CLS from other bacterial pathogens?

Salmonella heidelberg cardiolipin synthase exhibits both conserved features and distinctive characteristics when compared to CLS from other bacterial pathogens:

  • Structural conservation:

    • The basic catalytic mechanism is conserved across bacterial species

    • Core functional domains show high sequence similarity, particularly in the catalytic region

    • Transmembrane organization follows similar patterns across Gram-negative bacteria

  • Bacterial pathogen-specific adaptations:

    Bacterial SpeciesCLS TypeNotable FeaturesRelation to Pathogenesis
    Salmonella heidelbergBacterial-typeAssociated with MDR phenotypesMay enhance stress resistance during infection
    Trypanosoma brucei*Bacterial-typeEssential for parasite viabilityCritical for mitochondrial function and energy metabolism
    E. coliClsA, ClsB, ClsCThree paralogous enzymesFunctional redundancy provides robustness
    Mycobacterium tuberculosisSingle CLSDistinctive substrate preferencesContributes to unique mycobacterial membrane
    Pseudomonas aeruginosaSingle CLSUpregulated during biofilm formationImportant for chronic infection

    *While T. brucei is not a bacterial pathogen, it possesses a bacterial-type CLS that provides an interesting evolutionary comparison

  • Substrate specificity differences:

    • Variation in preferred acyl chain length and saturation in CDP-DAG substrates

    • Different PG substrate requirements across species

    • These differences may reflect adaptation to specific host environments or growth conditions

  • Regulatory network variations:

    • CLS expression is regulated differently across pathogens

    • Integration with stress response systems shows species-specific patterns

    • Some pathogens modulate CLS activity in response to host environments

The bacterial-type CLS found in T. brucei provides an interesting evolutionary comparison, as it represents a prokaryotic-type enzyme operating in a eukaryotic organism. Studies have shown that this enzyme is essential for parasite viability, with its depletion causing alterations in mitochondrial morphology and function . This parallels the importance of CLS in bacterial pathogens like Salmonella heidelberg, suggesting evolutionary conservation of function despite divergence in other aspects of cellular biology.

What evolutionary insights can be gained from studying Salmonella heidelberg CLS?

Studying Salmonella heidelberg CLS provides valuable evolutionary insights into bacterial adaptation and pathogen evolution:

  • Evolutionary conservation of membrane biosynthesis:

    • CLS represents an ancient and conserved pathway for membrane phospholipid synthesis

    • The basic catalytic mechanism has been maintained across diverse bacterial lineages

    • This conservation highlights the fundamental importance of cardiolipin in bacterial physiology

  • Horizontal gene transfer and resistance evolution:

    • Salmonella Heidelberg strains have horizontally acquired resistance to multiple antimicrobials

    • These resistant lineages show distinct geographical distribution patterns

    • Genomic analyses reveal both chromosomal integration and plasmid-borne resistance genes

    • The membrane environment, influenced by CLS activity, may affect the success of horizontal gene transfer

  • Paralog evolution and specialization:

    • While some bacteria possess multiple CLS paralogs with specialized functions, Salmonella has maintained a single CLS

    • This suggests different evolutionary strategies for membrane adaptation

    • The presence of bacterial-type CLS in eukaryotes like T. brucei indicates ancient endosymbiotic acquisition

  • Serovar-specific adaptations:

    • Different Salmonella serovars show variations in membrane composition

    • Salmonella Heidelberg has distinctive virulence and resistance profiles compared to other serovars

    • These differences may reflect adaptation to specific ecological niches and transmission patterns

  • Lipid metabolism as an evolutionary driver:

    • Changes in membrane composition can affect multiple aspects of bacterial physiology

    • Selection pressure on membrane properties may drive the evolution of enzymes like CLS

    • The co-evolution of membranes with cellular systems provides insight into bacterial adaptation

Genomic studies of global Salmonella isolates reveal that serovars like Concord (with similar evolutionary considerations to Heidelberg) are polyphyletic and distributed among multiple lineages with varying resistance profiles . This suggests that membrane adaptation through enzymes like CLS may have occurred independently in different lineages, potentially leading to convergent phenotypes optimized for specific environmental challenges.

How has the function of CLS changed during the evolution of different Salmonella serovars?

The evolution of CLS function across different Salmonella serovars reflects adaptation to diverse ecological niches and host environments:

  • Conservation of core function with serovar-specific tuning:

    • The fundamental cardiolipin synthesis mechanism is preserved across all Salmonella serovars

    • Fine-tuning of enzyme properties may occur through subtle sequence variations

    • These adaptations optimize membrane composition for specific host environments

  • Differential expression regulation:

    • Various Salmonella serovars show distinct patterns of CLS expression

    • Host-adapted serovars may have evolved specialized regulatory mechanisms

    • Environmental signals triggering CLS upregulation likely differ between serovars

  • Co-evolution with resistance mechanisms:

    • Salmonella Heidelberg has developed distinctive multidrug resistance profiles

    • CLS function may have co-evolved with resistance determinants

    • This is evidenced by the high proportion of MDR strains with unique resistance patterns

  • Adaptation to host range:

    • Host-restricted serovars show different membrane adaptation strategies compared to broad-host-range serovars

    • Salmonella Heidelberg's membrane adaptations may contribute to its success in various hosts

    • Changes in cardiolipin content and distribution likely reflect host-specific challenges

  • Integration with virulence systems:

    • Different serovars possess unique virulence factor combinations

    • Salmonella Heidelberg uniquely contains the safABCD operon encoding adhesive fimbriae

    • CLS function may be optimized to support these serovar-specific virulence mechanisms

Comparative genomic analyses reveal that Salmonella serovars like Concord (with similar evolutionary considerations to Heidelberg) are distributed among multiple lineages, suggesting independent evolution of membrane adaptation strategies . Some lineages show restricted geographical distribution and high levels of antimicrobial resistance, while others are more widely distributed with lower resistance levels. This pattern suggests that CLS function may have evolved differently in these lineages, potentially influenced by local antimicrobial use practices and transmission patterns.

What are the most promising approaches for developing CLS inhibitors as potential antimicrobials against Salmonella heidelberg?

The development of CLS inhibitors as antimicrobials against Salmonella heidelberg offers several promising research directions:

  • Structure-based drug design:

    • Determination of Salmonella heidelberg CLS crystal structure

    • Identification of druggable pockets within the catalytic domain

    • Computational screening of compound libraries against these sites

    • Optimization of lead compounds through medicinal chemistry approaches

  • Substrate analog development:

    • Design of non-hydrolyzable CDP-DAG analogs

    • Phosphonate-based PG mimetics that bind but prevent catalysis

    • Lipid-based inhibitors with enhanced membrane penetration

  • Targeting unique bacterial CLS features:

    • Focus on structural elements absent in human CLS

    • Development of inhibitors that specifically disrupt bacterial TMD organization

    • Compounds that interfere with bacterial-specific substrate binding modes

  • Allosteric inhibition strategies:

    • Identification of regulatory sites outside the catalytic domain

    • Screening for compounds that lock CLS in inactive conformations

    • Peptide-based inhibitors targeting protein-protein interaction sites

  • Combination approaches:

    • CLS inhibitors combined with existing antibiotics

    • Targeting multiple enzymes in the cardiolipin synthesis pathway

    • Membrane-disrupting agents that synergize with CLS inhibition

Such inhibitors could be particularly effective against MDR Salmonella Heidelberg strains, which already demonstrate resistance to multiple antibiotic classes . The high hospitalization rate associated with these strains (35%) underscores the need for novel therapeutic approaches . By targeting CLS, which affects fundamental membrane properties, these inhibitors might overcome existing resistance mechanisms and provide new options for treatment of severe infections.

How can genetic engineering of Salmonella heidelberg CLS be used for fundamental research and biotechnological applications?

Genetic engineering of Salmonella heidelberg CLS offers diverse opportunities for both fundamental research and biotechnological applications:

  • Fundamental research applications:

    • Creation of conditional CLS knockouts to study essentiality under various conditions

    • Site-directed mutagenesis to identify critical residues for catalysis and substrate binding

    • Domain swapping with CLS from other organisms to understand functional evolution

    • Engineering reporter fusions to monitor CLS expression and localization in real-time

    • CRISPR-based CLS regulation to study membrane adaptation dynamics

  • Biotechnological applications:

    • Vaccine development:

      • Attenuated Salmonella strains with modified CLS as live vaccines

      • Engineered membrane composition to enhance immunogenicity

      • Controlled membrane properties to improve vaccine stability

    • Bioproduction platforms:

      • Engineered Salmonella with modified membranes for recombinant protein production

      • Optimized cardiolipin content to enhance secretion system efficiency

      • Strains with increased membrane stability for industrial processes

    • Diagnostic tools:

      • Engineered reporter strains to detect CLS inhibitors

      • Biosensors based on CLS activity for antimicrobial discovery

      • Systems to identify compounds that affect membrane integrity

  • Structural biology advances:

    • Expression systems for producing modified CLS variants

    • Engineering stabilized CLS for crystallography studies

    • Creation of minimal CLS constructs for NMR structural analysis

  • Synthetic biology approaches:

    • Redesign of CLS to accept non-natural substrates

    • Engineering synthetic cardiolipin variants with novel properties

    • Creation of orthogonal membrane systems in bacterial cells

The experiences with chimeric constructs containing transmembrane domains from different proteins provide valuable insights for these engineering approaches. Research has shown that swapping TMDs (as in LepB+0 constructs) significantly affects CLS activity, highlighting the importance of domain organization for function . These findings can guide rational engineering of CLS variants with desired properties for research and biotechnological applications.

What are the current technical challenges in studying recombinant Salmonella heidelberg CLS and how might they be overcome?

Studying recombinant Salmonella heidelberg CLS presents several technical challenges that require innovative solutions:

  • Expression and purification challenges:

    • Challenge: Membrane proteins like CLS are difficult to express in functional form

    • Solutions:

      • Use specialized expression strains (C41/C43)

      • Employ fusion partners that enhance folding and solubility

      • Explore cell-free expression systems with defined membrane mimetics

      • Develop mild solubilization protocols using newer detergents (LMNG, GDN)

  • Structural characterization limitations:

    • Challenge: Obtaining high-resolution structural data for membrane proteins

    • Solutions:

      • Apply cryo-EM for structure determination without crystallization

      • Use hydrogen-deuterium exchange mass spectrometry for dynamics

      • Implement solid-state NMR approaches for membrane-embedded CLS

      • Develop computational models validated by cross-linking data

  • Functional assay constraints:

    • Challenge: Current assays often require radioactive materials or complex setups

    • Solutions:

      • Develop fluorescence-based continuous assays

      • Create high-throughput screening platforms

      • Implement label-free detection methods (mass spectrometry, NMR)

      • Design biosensor systems for in vivo activity monitoring

  • In vivo relevance issues:

    • Challenge: Connecting in vitro findings to in vivo function

    • Solutions:

      • Develop conditional expression systems in Salmonella

      • Create reporter strains that monitor cardiolipin levels

      • Implement metabolic labeling approaches for in vivo tracking

      • Use advanced imaging techniques for cardiolipin visualization

  • Heterogeneity problems:

    • Challenge: Natural variation in lipid composition affects reproducibility

    • Solutions:

      • Define synthetic minimal lipid environments

      • Standardize growth conditions to normalize membrane composition

      • Implement single-molecule approaches to account for heterogeneity

      • Develop computational models that incorporate composition variables

Research has shown that proper orientation of transmembrane domains is critical for CLS function, as demonstrated in engineered constructs with altered TMD arrangements . This suggests that maintaining native-like membrane environments during recombinant expression and analysis is crucial. Similarly, studies with human CLS expressed in COS-7 cells demonstrated that cellular context affects enzyme function, highlighting the importance of appropriate expression systems .

Combining these approaches with advanced genetic tools for Salmonella manipulation would enable more comprehensive study of CLS function in both fundamental research and applications for antimicrobial development against multidrug-resistant strains .

What are the most significant unresolved questions about Salmonella heidelberg CLS that require further investigation?

Despite progress in understanding cardiolipin synthase in various organisms, several critical questions about Salmonella heidelberg CLS remain unresolved:

  • Structure-function relationships:

    • What is the high-resolution structure of Salmonella heidelberg CLS?

    • How does the enzyme's structure change during the catalytic cycle?

    • Which specific residues are essential for substrate recognition and catalysis?

    • How do transmembrane domains influence the positioning of the catalytic domain?

  • Regulation mechanisms:

    • How is CLS expression regulated during infection and stress responses?

    • What environmental signals modulate CLS activity in vivo?

    • Are there post-translational modifications that affect enzyme function?

    • How is cardiolipin synthesis coordinated with other membrane biosynthesis pathways?

  • Role in antimicrobial resistance:

    • What is the direct contribution of CLS to the MDR phenotype in Salmonella Heidelberg?

    • How does cardiolipin distribution affect the function of resistance proteins?

    • Can modulation of CLS activity restore sensitivity to antibiotics?

    • Is there correlation between CLS sequence variants and resistance profiles?

  • Virulence connections:

    • How does cardiolipin distribution affect the localization and function of virulence factors?

    • Does CLS activity change during different stages of infection?

    • Is there direct interaction between CLS and components of virulence systems?

    • How does the safABCD operon (found in virulent strains) interact with membrane systems?

  • Evolutionary aspects:

    • How has CLS function diverged across Salmonella serovars?

    • What selective pressures drive CLS sequence evolution?

    • How does horizontal gene transfer of resistance genes interact with membrane adaptation?

    • Are there strain-specific adaptations in CLS that enhance fitness in particular hosts?

Addressing these questions will require integrative approaches combining structural biology, genetic engineering, advanced imaging, and infection models. The complex relationship between membrane composition, resistance, and virulence in Salmonella Heidelberg makes this a particularly rich area for investigation with implications for both fundamental understanding and therapeutic development.

How might advances in synthetic biology and protein engineering transform our ability to study and utilize Salmonella heidelberg CLS?

Advances in synthetic biology and protein engineering offer transformative approaches for studying and utilizing Salmonella heidelberg CLS:

These approaches would significantly enhance our understanding of the fundamental role of CLS in Salmonella physiology and pathogenesis. Research has already demonstrated the importance of transmembrane domain organization for CLS function , and protein engineering approaches could further explore this relationship. Similarly, studies with human CLS have shown the feasibility of recombinant expression and functional characterization , providing a foundation for more advanced synthetic biology applications with bacterial CLS.

The high prevalence of multidrug resistance in Salmonella Heidelberg makes this an important system for developing new approaches to overcome antimicrobial resistance, potentially through targeting membrane biosynthesis pathways or using engineered CLS variants as components of novel therapeutic strategies.

What lessons from Salmonella heidelberg CLS research might be applicable to addressing global antimicrobial resistance challenges?

Research on Salmonella heidelberg CLS provides valuable insights that could inform broader strategies for addressing global antimicrobial resistance challenges:

  • Membrane-targeted therapeutic approaches:

    • CLS research highlights the critical role of membrane composition in bacterial physiology

    • Targeting membrane biosynthesis represents an underexplored strategy for antimicrobial development

    • Combination therapies that disrupt membrane homeostasis may overcome existing resistance mechanisms

    • Such approaches could be effective against diverse pathogens beyond Salmonella

  • One Health implications:

    • Salmonella Heidelberg outbreaks demonstrate the interconnection between animal and human health

    • CLS-related membrane adaptations likely play roles in both host environments

    • Understanding these adaptations can inform agricultural and clinical antimicrobial use policies

    • Integrated surveillance of membrane-related resistance mechanisms could provide early warnings

  • Novel diagnostic strategies:

    • Membrane composition changes associated with resistance could serve as diagnostic biomarkers

    • Rapid tests detecting CLS activity or cardiolipin levels might predict treatment outcomes

    • These approaches could enable more targeted antimicrobial therapy

    • Point-of-care diagnostics based on these principles could improve stewardship globally

  • Basic research translation:

    • Fundamental studies of bacterial membrane biology reveal potential intervention points

    • Evolutionary analysis of CLS across pathogens identifies conserved vulnerabilities

    • Structural studies can guide rational drug design targeting essential membrane processes

    • Understanding resistance-virulence connections informs risk assessment of emerging strains

  • Alternative strategies to antibiotics:

    • CLS-based membrane engineering might create effective live attenuated vaccines

    • Biological control strategies targeting membrane integrity could replace conventional antibiotics

    • Phage therapy approaches could be enhanced by understanding membrane adaptation mechanisms

    • Anti-virulence strategies might be developed by disrupting membrane domain organization

The prevalence of MDR in Salmonella has increased over time, making severe infections increasingly difficult to treat with empirical antimicrobial therapy . Research on Salmonella Heidelberg has revealed complex resistance profiles with nonsusceptibility to up to 11 antimicrobial agents, highlighting the urgency of developing alternative approaches . Global genomic analysis of related Salmonella serovars demonstrates the worldwide spread of resistant lineages, underscoring the need for coordinated international responses .

By applying lessons from CLS research to the broader challenge of antimicrobial resistance, we may identify novel intervention points and develop strategies that remain effective despite the continued evolution of resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.