Recombinant Salmonella heidelberg Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

CobS is essential for nucleotide loop assembly in cobalamin biosynthesis. It condenses adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-5′-phosphate (α-RP) to form AdoCbl-P, which is subsequently dephosphorylated by CobC to yield active AdoCbl . This reaction occurs in a membrane-associated complex involving CobU (kinase/guanylyltransferase), CobT (phosphoribosyltransferase), and CobC (phosphatase) .

Key Steps in AdoCbl Biosynthesis:

EnzymeSubstrateProduct
CobUAdoCbi → AdoCbi-phosphate → AdoCbi-GDPAdoCbi-GDP
CobTNicotinate mononucleotide (NaMN) + 5,6-dimethylbenzimidazole (DMB)α-RP
CobSAdoCbi-GDP + α-RPAdoCbl-P
CobCAdoCbl-PAdoCbl

Data synthesized from in vitro reconstitution studies .

CobS’s membrane association is conserved across cobamide-producing bacteria, though its physiological relevance remains under investigation .

Recombinant Production and Experimental Applications

Recombinant cobS is typically produced via heterologous expression systems (e.g., E. coli), enabling purification and biochemical characterization. Key methodologies include:

  • Cloning: The cobS gene is inserted into plasmids (e.g., pET vectors) under inducible promoters.

  • Purification: Affinity chromatography (e.g., His-tagged cobS) coupled with liposome reconstitution to enhance activity .

  • Functional Assays: In vitro synthesis of AdoCbl-P using purified CobU, CobT, and cobS .

Example Workflow for Recombinant cobS Production:

  1. Gene Cloning: Amplify cobS from Salmonella heidelberg genomic DNA.

  2. Expression: Induce recombinant protein production in E. coli with IPTG.

  3. Purification: Use Ni-NTA chromatography followed by size-exclusion chromatography.

  4. Activity Testing: Measure AdoCbl-P formation via HPLC or mass spectrometry .

Genomic Context in Salmonella Serovars:

SerovarCobalamin Biosynthetic OperoncobS Homolog Presence
Salmonella typhimurium25 genes in cob operonYes (validated in vitro)
Salmonella heidelbergNot explicitly mappedYes (inferred from genomic data)
Pseudomonas denitrificansDistinct operon structureYes (homologous to CobV)

Note: Salmonella heidelberg cobS homology is inferred from conserved synteny in enterobacteria .

Functional Variability:

  • Membrane Localization: Critical for cobS activity, as liposomes enhance substrate accessibility .

  • Substrate Specificity: Strictly requires AdoCbi-GDP and α-RP for AdoCbl-P synthesis .

  • Pathogenic Relevance: Cobalamin biosynthesis is crucial for Salmonella survival in anaerobic environments .

In Vitro Synthesis Breakthroughs

Recombinant cobS enables rapid synthesis of cobamides with modified lower-ligand bases, enabling studies on cofactor specificity in enzymatic reactions .

StudyKey FindingMethod
In vitro reconstitution CobS catalyzes AdoCbl-P synthesis from AdoCbi-GDP and α-RPHPLC, mass spectrometry
Liposome-enhanced activity Lipid bilayers stabilize cobS, improving catalytic efficiencyEnzyme kinetics
Multienzyme complex assembly CobS interacts with CobU, CobT, and CobC in membrane-bound complexesCo-purification assays

Unresolved Questions

  1. Physiological Role of Membrane Association: Why are cobS enzymes conserved as membrane proteins?

  2. CobS Variability in Salmonella Strains: Do genomic differences (e.g., plasmid-encoded cobS variants) influence cobalamin yield or resistance ?

Potential Applications

  • Biotechnology: Engineering cobS variants for industrial cobalamin production.

  • Antibiotic Development: Targeting cobS to disrupt pathogen metabolism in Salmonella infections.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
cobS; SeHA_C2239; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP with alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) in Salmonella species?

Cobalamin synthase (CobS) is a crucial enzyme in the adenosylcobalamin (vitamin B12) biosynthetic pathway in Salmonella. Based on in vitro studies with Salmonella typhimurium, CobS has been conclusively identified as the cobalamin(-5′-phosphate) synthase that catalyzes a key step in the nucleotide loop assembly pathway of adenosylcobalamin biosynthesis . This enzyme works in conjunction with other proteins including CobU, CobT, and CobC to complete the synthesis of this essential vitamin.

The experimental evidence supporting CobS function comes from reaction studies where adenosylcobinamide-GDP (the product of the CobU reaction) and α-ribazole-5′-phosphate (the product of the CobT reaction) were incubated with purified CobS, resulting in the synthesis of adenosylcobalamin-5′-phosphate . This reaction product was successfully isolated by HPLC, identified through UV-visible spectroscopy and mass spectrometry, and demonstrated to support the growth of cobalamin auxotrophs, providing definitive evidence of CobS's function .

What role does CobS play in Salmonella virulence and stress response?

While direct evidence linking CobS specifically to virulence in Salmonella heidelberg is not detailed in the search results, broader research on Salmonella heidelberg has revealed important connections between metabolic pathways and virulence mechanisms. During the 2013-2014 multistate outbreak of Salmonella heidelberg associated with poultry, the outbreak strains exhibited enhanced heat tolerance and stress response capabilities that may have contributed to the outbreak's unusual length and severity .

Transcriptomic analyses have shown that exposure to heat stress increases the expression of multidrug efflux and virulence genes in Salmonella heidelberg . Given that cobalamin is an essential cofactor for several metabolic processes, disruptions in its biosynthesis (including CobS function) could potentially impact bacterial fitness and virulence. The outbreak-associated isolates appeared to be "transcriptionally primed" to better survive processing stresses and potentially cause illness , suggesting complex regulatory networks that may involve metabolic pathways like cobalamin synthesis.

What are the optimal methods for expressing and purifying recombinant Salmonella heidelberg CobS?

Based on successful approaches with recombinant proteins from Salmonella, including CobS from S. typhimurium, researchers should consider the following methodological approach:

  • Vector Selection: The pT7-7 cloning vector has been successfully used for cobS expression as demonstrated in studies with S. typhimurium . For purification purposes, a His-tag modification (creating a (His)6CobS preparation) has proven effective .

  • Expression System: E. coli BL21(DE3) or similar expression strains are appropriate hosts for recombinant Salmonella protein expression.

  • Induction Conditions: IPTG induction at mid-log phase (OD600 ~0.6) with incubation at 30°C rather than 37°C may help improve soluble protein yield.

  • Purification Protocol:

    • Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol

    • For His-tagged constructs, use Ni-NTA affinity chromatography

    • Further purification via ion exchange chromatography

    • Final polishing step using size exclusion chromatography

  • Activity Preservation: Include 1-2 mM DTT in all buffers to maintain cysteine residues in reduced form, as oxidation may affect enzyme activity.

When working specifically with Salmonella heidelberg CobS, researchers should verify protein stability and activity immediately after purification, as enzymatic activity can diminish during storage.

How can the enzymatic activity of recombinant CobS be assayed in vitro?

The enzymatic activity of recombinant CobS can be assayed through several complementary approaches based on established protocols for S. typhimurium CobS :

Method 1: Bioassay using Cobalamin Auxotroph

  • Prepare a complete reaction mixture containing:

    • AdoCbi-GDP (1.2 nmol)

    • α-ribazole-5′-P (1.2 nmol)

    • Ches buffer (pH 9; 1 μmol)

    • MgCl₂ (50 nmol)

    • Purified CobS enzyme

    • Final volume: 20 μl

  • Stop the reaction by adding 20 μl of 20 mM KCN and incubating at 80°C for 10 min.

  • Test the reaction product using a cobalamin auxotroph strain (e.g., JE212 for S. typhimurium) to assess growth promotion .

Method 2: Quantitative Radioactive Assay

  • Prepare reaction mixture with radiolabeled substrates:

    • 0.3 nmol of [¹⁴C]α-ribazole-5′-P

    • 0.9 nmol of unlabeled α-ribazole-5′-P

    • Other components as in Method 1

  • Stop reaction with 5 μl of 100 mM KCN and heat at 80°C for 10 min.

  • Apply reactions to polyethyleneimine cellulose TLC plates.

  • Develop TLC plates with 0.1 M potassium phosphate (pH 8.0) containing 10 mM KCN.

  • Quantify using a PhosphorImager (α-ribazole-5′-P and CNCbl-5′-P migrate with Rf values of 0.33 and 0.43, respectively) .

Method 3: HPLC Analysis of Reaction Products

  • Prepare reaction as in Method 1.

  • Derivatize corrinoids with KCN.

  • Isolate products by RP-HPLC.

  • Identify by comparing retention times with standards:

    • (CN)₂Cbi: elutes at 32.3 min

    • (CN)₂Cbi-GDP: elutes at 29 min

    • CNCbl: elutes at 36.9 min

    • CNCbl-5'-P (CobS reaction product): elutes at 33.5-33.6 min

  • Confirm by UV-visible spectroscopy.

One unit of cobalamin synthase activity is defined as the amount of enzyme needed to generate 1 nmol of product per min .

What experimental approaches can determine the substrate specificity of Salmonella heidelberg CobS?

To determine the substrate specificity of Salmonella heidelberg CobS, researchers should employ a multi-faceted approach:

Biochemical Characterization with Substrate Analogs

  • Synthesize or obtain structural analogs of natural substrates (adenosylcobinamide-GDP and α-ribazole-5′-P)

  • Test each analog in the standard CobS assay (described in section 2.2)

  • Determine kinetic parameters (Km, Vmax, kcat) for each substrate variant

  • Create a substrate specificity profile based on relative activity with different analogs

Site-Directed Mutagenesis of Putative Substrate-Binding Residues

  • Identify conserved residues in the active site through sequence alignment with characterized CobS proteins

  • Generate point mutations of these residues

  • Express and purify mutant proteins

  • Assess activity with natural substrates and selected analogs

  • Correlate changes in activity with specific amino acid substitutions

Structural Biology Approach

  • Obtain crystal structures of CobS alone and in complex with substrates/analogs

  • Use computational docking to predict interactions with various substrates

  • Validate predictions through mutagenesis and activity assays

Comparative Analysis with Other Salmonella Strains

  • Clone, express, and characterize CobS from multiple Salmonella strains, including both heidelberg and non-heidelberg isolates

  • Compare substrate preferences and kinetic parameters

  • Correlate differences with specific sequence variations

These approaches should be complementary and iterative, with findings from one method informing experiments in the others. The data can be compiled into a comprehensive substrate specificity profile that provides insights into CobS function.

How might CobS function relate to Salmonella heidelberg virulence in foodborne outbreaks?

The relationship between CobS function and Salmonella heidelberg virulence presents an intriguing research area, particularly in light of recent outbreaks. During the 2013-2014 multistate outbreak of Salmonella heidelberg associated with poultry, affected individuals experienced unusually high rates of hospitalization (38% versus the typical 26%) and invasive illness (15% versus the typical 13%), suggesting enhanced virulence of the outbreak strains .

Transcriptomic studies revealed that outbreak-associated Salmonella heidelberg isolates had distinct gene expression patterns that may have contributed to their enhanced stress tolerance and virulence . While direct evidence linking CobS to this enhanced virulence is not presented in the search results, several hypothetical mechanisms warrant investigation:

  • Metabolic Fitness: Cobalamin is essential for several metabolic pathways. Enhanced or altered CobS function could potentially improve bacterial fitness during infection.

  • Stress Response Integration: Heat stress (a common processing intervention) increased expression of multidrug efflux and virulence genes in Salmonella heidelberg . The cobalamin biosynthetic pathway might be integrated with stress response networks.

  • Nutrient Acquisition: During infection, pathogens must compete with the host and microbiota for essential nutrients. More efficient cobalamin synthesis could provide a competitive advantage.

  • Regulatory Networks: CobS-dependent metabolic pathways might influence regulatory networks controlling virulence gene expression.

To investigate these possibilities, researchers could compare cobS sequences and expression levels between outbreak and non-outbreak strains, create cobS mutants and assess their virulence in appropriate models, or perform transcriptomic analyses to identify correlations between cobS expression and virulence factors under various conditions.

What comparative approaches can reveal differences in CobS between outbreak and non-outbreak strains?

To uncover potential differences in CobS between outbreak and non-outbreak strains of Salmonella heidelberg, researchers should employ a multi-level comparative approach:

Genomic Comparison

  • Sequence the cobS gene and flanking regions from multiple outbreak and non-outbreak strains

  • Perform SNP analysis to identify potentially functional variations

  • Examine regulatory regions for mutations that might affect expression

  • Assess copy number variations that might influence gene dosage

Transcriptomic Analysis

  • Compare cobS expression levels under standard conditions and relevant stress conditions (heat, acid, etc.)

  • Analyze the entire transcriptome to identify co-regulated genes

  • Study the timing and magnitude of cobS expression during simulated infection conditions

  • Similar to approaches used in analyzing heat stress responses in Salmonella heidelberg

Proteomic Investigation

  • Quantify CobS protein levels in different strains

  • Identify post-translational modifications that might affect activity

  • Examine protein-protein interactions using co-immunoprecipitation or crosslinking studies

  • Compare enzymatic activity using methods described in section 2.2

Functional Characterization

  • Express recombinant CobS from different strains

  • Compare enzymatic parameters (Km, Vmax, substrate specificity)

  • Assess stability under various stress conditions

  • Create hybrid proteins to map functional differences to specific protein regions

In vivo Relevance

  • Generate isogenic strains differing only in their cobS alleles

  • Compare stress tolerance, colonization ability, and virulence

  • Assess competitive fitness during co-infection experiments

  • Measure in vivo expression using reporter constructs

This comprehensive approach would provide insights into whether CobS variations contribute to the enhanced stress tolerance and virulence observed in outbreak strains.

What is the potential of recombinant CobS as a target for antimicrobial development?

The potential of recombinant Salmonella heidelberg CobS as a target for antimicrobial development warrants serious consideration due to several favorable characteristics:

1. Essentiality and Metabolic Importance
Cobalamin is essential for several metabolic pathways in Salmonella. Disruption of its biosynthesis through CobS inhibition could potentially impair bacterial growth and virulence. This is particularly relevant for strains exhibiting enhanced stress tolerance and virulence, such as those involved in recent outbreaks .

2. Structural Uniqueness
The cobalamin biosynthetic pathway is absent in humans (who obtain vitamin B12 through diet), making CobS an attractive target for selective inhibition. Drugs targeting this enzyme would likely have minimal direct effects on human enzymes, potentially reducing side effects.

3. Methodological Approaches for Inhibitor Development
Researchers could pursue several strategies for developing CobS inhibitors:

  • High-Throughput Screening:

    • Express and purify recombinant Salmonella heidelberg CobS

    • Develop a robust, miniaturized version of the enzyme assays described in section 2.2

    • Screen compound libraries for inhibitory activity

    • Conduct counter-screens against human enzymes to ensure selectivity

  • Structure-Based Drug Design:

    • Determine the crystal structure of CobS, ideally in complex with substrates

    • Identify and characterize the active site and potential allosteric sites

    • Design compounds that specifically bind these sites

    • Optimize lead compounds through iterative structural studies

  • Fragment-Based Approach:

    • Screen libraries of low-molecular-weight compounds for weak binding to CobS

    • Identify binding hotspots using NMR or X-ray crystallography

    • Link or grow fragments to develop more potent inhibitors

    • Optimize for drug-like properties while maintaining selectivity

4. Potential Advantages as an Antibiotic Target
CobS inhibitors might be particularly valuable against Salmonella heidelberg strains that show enhanced stress tolerance, such as those involved in the 2013-2014 outbreak . By targeting a metabolic pathway potentially linked to stress survival, such inhibitors could help combat strains that resist conventional processing interventions.

How can epitope mapping approaches used for other Salmonella proteins be applied to CobS?

Epitope mapping approaches successfully applied to other Salmonella proteins, such as the FlgK protein in Salmonella heidelberg , can be adapted for CobS analysis. These methods combine in silico prediction with experimental validation to identify immunologically relevant epitopes.

Methodological Approach for CobS Epitope Mapping:

In Silico Prediction

  • Analyze the CobS sequence using immunoinformatic tools similar to those used for FlgK analysis

  • Predict B-lymphocyte epitopes based on:

    • Antigenicity

    • Surface accessibility

    • Hydrophilicity

    • Flexibility

    • Secondary structure

Experimental Validation

  • Express recombinant CobS protein using established protocols

  • Generate antibodies against the recombinant protein

  • Perform immunoprecipitation combined with mass spectrometry (similar to the approach used for FlgK)

  • Compare experimentally identified epitopes with in silico predictions to identify consensus regions

Conformational Epitope Analysis

  • Use structural modeling to identify potential conformational epitopes

  • Validate through site-directed mutagenesis and immunological assays

  • Apply hydrogen/deuterium exchange mass spectrometry to map epitope-antibody interactions

Validation in Animal Models

  • Test immunogenicity of identified epitopes in appropriate animal models

  • Assess protective capacity against Salmonella heidelberg challenge

  • Evaluate cross-protection against different strains and serovars

This comprehensive approach would leverage the successful methods used for FlgK epitope mapping while tailoring the process to the specific characteristics of CobS.

What are the advantages of using recombinant CobS versus whole-cell approaches for immunological studies?

When conducting immunological studies on Salmonella heidelberg, researchers must decide between using recombinant CobS protein and whole-cell approaches. Each strategy offers distinct advantages and limitations:

Advantages of Recombinant CobS Protein:

  • Precise Epitope Identification: Isolated recombinant CobS allows for detailed epitope mapping at the molecular level, similar to the approaches used for FlgK protein epitope identification . This precision is difficult to achieve with whole-cell approaches.

  • Controlled Antigen Presentation: Researchers can precisely control antigen concentration, conformation, and post-translational modifications, leading to more reproducible immune responses.

  • Reduced Biological Variability: Using purified protein eliminates variables associated with whole bacteria, such as growth phase-dependent expression differences and strain-to-strain variations.

  • Safety Advantages: Recombinant proteins eliminate safety concerns associated with working with pathogenic Salmonella heidelberg strains, especially those with enhanced virulence like the outbreak strains .

  • Quantitative Analysis: Protein-based immunological assays typically offer better quantitative precision than whole-cell approaches.

Disadvantages and Limitations:

  • Conformational Authenticity: Recombinant proteins may not always fold identically to their native counterparts, potentially affecting epitope presentation.

  • Immunological Context: Isolated proteins lack the immunological context provided by bacterial cell surface structures that may influence immune recognition.

  • Post-translational Modifications: Depending on the expression system, recombinant CobS may lack authentic post-translational modifications that could be immunologically relevant.

  • Technical Challenges: Successful expression, purification, and storage of functionally active recombinant CobS requires optimization, as demonstrated by the detailed protocols developed for S. typhimurium CobS .

Recommended Hybrid Approach:
For comprehensive immunological characterization, researchers should consider a hybrid approach that leverages both strategies:

  • Begin with recombinant CobS to identify specific epitopes and develop initial immunological reagents

  • Validate findings using whole-cell approaches with wild-type and cobS mutant strains

  • Confirm the accessibility and immunogenicity of identified epitopes in the context of intact bacteria

  • Evaluate the conservation of immunologically relevant features across different clinical isolates

This integrated strategy would provide both molecular precision and biological relevance.

How might systems biology approaches advance our understanding of CobS in Salmonella heidelberg?

Systems biology approaches offer powerful frameworks for understanding CobS function within the broader context of Salmonella heidelberg metabolism, stress response, and virulence. Given the complex phenotypes observed in outbreak strains, such as enhanced heat tolerance and stress response , these approaches could reveal important insights:

Multi-omics Integration

  • Combine transcriptomics, proteomics, and metabolomics data to map the regulatory networks involving CobS

  • Compare profiles between outbreak and non-outbreak strains under various conditions

  • Identify condition-specific co-expression patterns that link cobalamin synthesis with stress response pathways

  • Build on existing transcriptomic analysis of heat stress responses in Salmonella heidelberg

Metabolic Flux Analysis

  • Use isotope-labeled precursors to trace cobalamin biosynthesis in vivo

  • Compare metabolic flux through the pathway in different strains and conditions

  • Identify rate-limiting steps that might be targeted for intervention

  • Integrate with genome-scale metabolic models of Salmonella

Protein-Protein Interaction Networks

  • Map the interactome of CobS using techniques such as affinity purification-mass spectrometry

  • Identify previously unknown protein interactions that might regulate CobS function

  • Compare interaction networks between outbreak and non-outbreak strains

  • Link to established virulence and stress response networks

Computational Modeling

  • Develop kinetic models of the cobalamin biosynthetic pathway

  • Simulate the effects of environmental perturbations on pathway flux

  • Predict the consequences of genetic variations observed in different strains

  • Identify potential feedback mechanisms that link cobalamin synthesis to stress response

Genome-Wide Association Studies

  • Analyze relationships between cobS sequence variations and phenotypic traits across large strain collections

  • Identify epistatic interactions that might explain strain-specific phenomena

  • Link specific genetic features to enhanced survival or virulence capabilities

By integrating these systems biology approaches, researchers could develop a comprehensive understanding of how CobS functions within the complex regulatory networks of Salmonella heidelberg, potentially revealing new targets for intervention in outbreak-associated strains.

What technological advances might improve recombinant CobS production and characterization?

Several emerging technologies hold promise for enhancing the production and characterization of recombinant Salmonella heidelberg CobS:

Advanced Expression Systems

  • Cell-Free Protein Synthesis: Rapid production of CobS without cellular constraints, allowing for incorporation of non-canonical amino acids for structural studies

  • Bacillus-Based Expression: Alternative to E. coli that may provide better folding for Gram-negative bacterial proteins

  • Inducible Promoter Technologies: Finely tuned expression systems to optimize yield while minimizing toxicity

  • Molecular Chaperone Co-Expression: Targeted approaches to improve folding and solubility

Purification and Structural Analysis

  • Automated Chromatography Platforms: High-throughput optimization of purification conditions

  • Microfluidic Purification Devices: Rapid small-scale purification for variant screening

  • Cryo-EM Advances: Near-atomic resolution structures without crystallization

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Detailed conformational dynamics analysis

  • Single-Molecule FRET: Real-time observation of conformational changes during catalysis

Functional Characterization

  • Microfluidic Enzyme Assays: Ultra-low volume, high-sensitivity detection of CobS activity

  • Nanopore Enzyme Analysis: Single-molecule detection of substrate binding and product release

  • Label-Free Biosensors: Real-time monitoring of CobS activity without modification of substrates

  • Advanced Mass Spectrometry: Improved detection of reaction intermediates and products

Computational Tools

  • AI-Driven Protein Design: Computational optimization of CobS stability and activity

  • Molecular Dynamics Simulations: Improved understanding of substrate binding and catalysis

  • Quantum Mechanical/Molecular Mechanical (QM/MM) Calculations: Detailed modeling of the CobS reaction mechanism

  • Network Analysis Tools: Better integration of CobS function within cellular pathways

These technological advances would enable more detailed characterization of CobS structure-function relationships, potentially revealing features that contribute to the enhanced stress tolerance and virulence observed in outbreak strains of Salmonella heidelberg .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.