Recombinant Salmonella heidelberg Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Salmonella heidelberg Electron transport complex protein RnfE (rnfE) is a genetically engineered protein involved in microbial electron transport systems. It is produced by cloning the rnfE gene from S. heidelberg into expression systems like Escherichia coli, followed by purification for research applications . This protein is part of the Rnf (Rhodobacter nitrogen fixation) complex, which bridges redox reactions between ferredoxin and NADH, playing a critical role in energy conservation and ion translocation .

Table 1: Physicochemical Properties of Recombinant RnfE

PropertyValueSource
Amino Acid Length193 residues
Molecular Weight~21.5 kDa
Theoretical Isoelectric Point (pI)Calculated as 5.2–5.8
StabilityStable (instability index <40)
Expression SystemE. coli, yeast, mammalian cells

Biological Function and Mechanism

The Rnf complex, including RnfE, facilitates electron transfer from reduced ferredoxin to NAD⁺, generating a sodium ion gradient across the membrane. This process is critical for:

  • ATP synthesis via ion gradient-driven ATPases .

  • Cellular redox balance by modulating NADH/NAD⁺ ratios .

  • Pathogen survival under low-oxygen conditions, as observed in Salmonella infections .

Research Applications

Recombinant RnfE is utilized in:

  1. Vaccine Development: As an antigen for antibody production against Salmonella .

  2. Metabolic Studies: To dissect electron transport pathways in pathogenic bacteria .

  3. Antimicrobial Resistance (AMR) Research: Investigating links between electron transport efficiency and AMR persistence .

Challenges and Future Directions

  • Structural Resolution: The lack of a full 3D structure limits mechanistic insights .

  • Role in Virulence: Further studies are needed to link RnfE activity to Salmonella pathogenicity .

  • Industrial Applications: Optimizing expression yields for large-scale immunological studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type preference, please inform us, and we will prioritize development with your specified tag.
Synonyms
rsxE; SeHA_C1624; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that facilitates electron transfer coupled with ion translocation across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Electron Transport Complex Protein RnfE in Salmonella heidelberg?

Electron transport complex protein RnfE is a critical component of the Rnf complex in Salmonella heidelberg, functioning as part of the bacterial electron transport chain. The RnfE protein (B4THD1) consists of 230 amino acids and is encoded by the rsxE gene (also known as rnfE). The protein features multiple transmembrane domains that facilitate its function in electron transport across the bacterial membrane. The full amino acid sequence is: MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV . The protein's structure includes predominantly hydrophobic regions that allow it to be embedded within the cell membrane, where it participates in energy metabolism processes essential for bacterial survival.

How does the RnfE protein relate to the Rnf complex in bacterial metabolism?

The RnfE protein functions as an integral component of the Rnf (Rhodobacter nitrogen fixation) complex, which serves as a membrane-bound electron transport system in many bacteria including Salmonella heidelberg. This complex plays a crucial role in energy conservation by coupling the oxidation of ferredoxin to the reduction of NAD+, generating a sodium ion gradient across the membrane. RnfE works in conjunction with other Rnf proteins, such as RnfA (another electron transport complex protein), to facilitate electron transfer during cellular respiration . The specific role of RnfE involves forming part of the transmembrane channel through which ions are translocated, contributing to the establishment of electrochemical gradients that can be utilized for ATP synthesis. Understanding this protein's function provides insights into bacterial energy metabolism and potential targets for antimicrobial development.

What are the standard methods for expressing recombinant RnfE protein?

Standard expression of recombinant Salmonella heidelberg RnfE protein typically employs E. coli as the host organism due to its well-established genetic manipulation protocols and high protein yields. The process begins with cloning the rnfE gene into a suitable expression vector containing an appropriate promoter (commonly T7 or lac) and a His-tag sequence for purification purposes. After transformation into a compatible E. coli strain (such as BL21(DE3)), protein expression is induced using IPTG or similar inducers . For membrane proteins like RnfE, expression conditions often require optimization, including lower induction temperatures (16-25°C), reduced inducer concentrations, and extended expression periods to facilitate proper protein folding and membrane insertion. Following expression, cells are harvested by centrifugation and the protein is extracted using detergents to solubilize the membrane fraction, followed by purification via immobilized metal affinity chromatography (IMAC) utilizing the His-tag . This approach typically yields protein with greater than 90% purity as determined by SDS-PAGE analysis.

What storage and handling conditions are recommended for recombinant RnfE protein preparations?

For optimal stability and activity of recombinant RnfE protein, specific storage and handling protocols must be followed. The purified protein is typically provided as a lyophilized powder or in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . When reconstituting lyophilized protein, it is recommended to briefly centrifuge the vial before opening and then dissolve the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, the addition of 5-50% glycerol (with 50% being the standard final concentration) is recommended to prevent freeze-thaw damage, and the protein should be aliquoted and stored at -20°C or preferably -80°C . Working aliquots can be maintained at 4°C for up to one week. It is crucial to avoid repeated freeze-thaw cycles as this significantly diminishes protein stability and activity. When handling the protein for experiments, maintaining a consistent temperature and gentle mixing techniques helps preserve the native conformation and function of this membrane-associated protein.

How can Design of Experiments (DOE) be applied to optimize RnfE protein purification?

Design of Experiments (DOE) methodologies provide a systematic framework for optimizing the purification of recombinant RnfE protein from Salmonella heidelberg. This approach identifies critical parameters affecting purification efficiency and their optimal ranges through statistical analysis. For membrane proteins like RnfE, a response surface matrix custom design can be implemented using software such as JMP to evaluate multiple parameters simultaneously . Key factors to consider include pH binding conditions (typically ranging from 4.75-6.75), salt concentration during binding (0-400 mM NaCl), pH elution conditions (6.0-8.75), and salt concentration during elution (0-1,000 mM NaCl) . The experimental matrix should include center points (typically three) to assess experimental variability and non-linearity in response variables.

Following the DOE framework, prepare a series of spin columns with appropriate chromatography media (such as Nuvia cPrime Hydrophobic Cation Exchange Resin for RnfE purification) according to the experimental conditions defined by the software . Analyze the resulting data for three primary responses: binding efficiency, yield, and purity of the target protein. Statistical analysis of these results will identify the optimal conditions and the relative importance of each parameter, allowing for the development of a robust purification protocol tailored specifically for RnfE protein. This approach significantly reduces development time compared to traditional one-factor-at-a-time optimization methods.

What strategies address the challenges in studying membrane-associated electron transport proteins like RnfE?

Studying membrane-associated electron transport proteins such as RnfE presents unique challenges that require specialized approaches. One primary challenge is maintaining protein stability and native conformation outside the membrane environment. Researchers can address this by utilizing mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin during extraction and purification, which preserve protein structure by mimicking the lipid bilayer . Alternatively, nanodiscs or liposome reconstitution can provide a more native-like environment for functional studies.

For structural analysis, techniques such as cryo-electron microscopy have proven valuable for membrane proteins, circumventing the difficulties associated with traditional X-ray crystallography. When investigating electron transport functionality, specialized electrochemical techniques like protein film voltammetry can be employed to measure electron transfer rates in controlled environments.

Expression systems present another significant challenge, as overexpression of membrane proteins often leads to toxicity or inclusion body formation. This can be mitigated by using specialized E. coli strains (such as C41/C43(DE3) or Lemo21(DE3)) designed for membrane protein expression, coupled with tightly controlled induction protocols . Co-expression with molecular chaperones may further enhance proper folding and membrane insertion.

Finally, for activity assays, coupling electron transport to detectable outputs such as reduction of artificial electron acceptors (e.g., benzyl viologen) or tracking ion gradients using fluorescent probes can provide quantitative measurements of RnfE function in reconstituted systems or membrane preparations.

How can contradictions in experimental data regarding RnfE function be reconciled and interpreted?

Contradictions in experimental data concerning RnfE function should be approached systematically rather than dismissing conflicting results. The first step is to carefully examine methodological differences between studies, as variations in protein preparation, buffer compositions, detergent types, or assay conditions can significantly impact results . Creating a detailed comparison table of experimental parameters across studies can help identify potential sources of variation.

Context-dependent contradictions are particularly common with membrane proteins like RnfE, where function may vary based on lipid composition, pH, or ion concentrations . In such cases, both contradicting results may be valid under their specific conditions, providing valuable insights into the protein's adaptability. This understanding can be enhanced by conducting experiments across a gradient of conditions to map the complete functional profile of RnfE.

Contradictions between structural predictions and functional data should be addressed through complementary approaches. For instance, if computational predictions of transmembrane domains contradict biochemical data, techniques such as site-directed spin labeling combined with electron paramagnetic resonance spectroscopy can provide direct experimental evidence of membrane topology.

When analyzing contradictions between in vitro and in vivo results, consider that simplified in vitro systems may lack essential components present in the cellular environment . Bridging this gap might require progressively more complex reconstitution systems, adding components systematically to identify factors influencing RnfE function.

Finally, contradictory findings should be explicitly reported and discussed in publications rather than selectively presenting only consistent data, as apparent contradictions often lead to deeper mechanistic insights and new research directions.

What are the current methodologies for analyzing the interaction of RnfE with other components of the electron transport chain?

Analysis of RnfE interactions with other electron transport chain components requires a multi-faceted approach combining biochemical, biophysical, and computational methods. Co-immunoprecipitation coupled with mass spectrometry represents a powerful starting point, allowing identification of protein complexes that associate with tagged RnfE under various physiological conditions. This can be complemented by bacterial two-hybrid assays to verify direct protein-protein interactions, particularly with other Rnf complex subunits such as RnfA .

For more detailed interaction analysis, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provide quantitative binding parameters including association/dissociation constants and thermodynamic profiles. When studying the dynamics of electron transfer, pulsed electron-electron double resonance (PELDOR) spectroscopy can measure distances between paramagnetic centers in different components, offering insights into the structural organization of the complex during electron transport.

Functional interaction studies benefit from reconstitution approaches where purified RnfE is incorporated into liposomes along with proposed interaction partners, followed by measuring electron transport activity using spectrophotometric assays with artificial electron donors/acceptors. Alternatively, nanoscale apolipoprotein-bound bilayers (nanodiscs) provide a more controlled environment for studying interactions while maintaining a membrane-like context.

Computational approaches, including molecular dynamics simulations of RnfE within a membrane environment, can predict potential interaction interfaces that can then be validated through site-directed mutagenesis of predicted contact residues followed by functional assays. Cross-linking studies coupled with mass spectrometry (XL-MS) provide experimental validation of these predictions by identifying specific amino acid residues involved in protein-protein contacts.

How is RnfE being utilized in recombinant Salmonella vaccine development?

The Salmonella electron transport complex protein RnfE is being explored as a component in recombinant attenuated Salmonella vaccine (RASV) development through multiple approaches. Researchers are investigating RnfE as both an antigen delivery system and as a target for attenuation strategies. As part of the electron transport chain, modifications to RnfE can create metabolically attenuated Salmonella strains that maintain immunogenicity while reducing virulence, making them suitable vaccine vectors . These attenuated strains can establish limited infection within host tissues, effectively delivering antigens to immune cells within gut-associated lymphoid tissue (GALT) without causing disease.

The immunogenic properties of RnfE are also being exploited by incorporating the protein or its epitopes into heterologous antigen constructs. When expressed in recombinant Salmonella, these constructs can stimulate both humoral and cell-mediated immune responses against target pathogens. Studies have demonstrated that such vaccines can induce protection against bacterial, viral, and parasitic infections in animal models .

Implementation strategies include creating live-attenuated Salmonella heidelberg strains with modified RnfE expression that can colonize mucosal-associated lymphoid tissues (MALT), where they interact with antigen-presenting cells to stimulate immune responses . These vaccines are administered orally, which mimics the natural route of infection and induces robust mucosal immunity. Current research focuses on optimizing expression systems, determining appropriate dosing regimens, and assessing long-term immunity following vaccination with these recombinant strains.

What analytical techniques are most effective for characterizing post-translational modifications of RnfE?

Characterization of post-translational modifications (PTMs) in the membrane-associated RnfE protein requires a sophisticated analytical workflow combining multiple complementary techniques. Mass spectrometry-based approaches form the foundation of comprehensive PTM analysis, with liquid chromatography-tandem mass spectrometry (LC-MS/MS) being particularly effective. Sample preparation is critical and typically involves enrichment strategies specific to the PTM of interest – immobilized metal affinity chromatography for phosphopeptides, lectins for glycopeptides, or antibody-based enrichment for acetylation, methylation, or ubiquitination.

For comprehensive characterization, a combination of fragmentation techniques should be employed, including collision-induced dissociation (CID), higher-energy collisional dissociation (HCD), and electron transfer dissociation (ETD), as each provides complementary information about modification sites and types. Data analysis requires specialized software capable of identifying modified peptides and distinguishing between isomeric modifications.

Western blotting with modification-specific antibodies provides validation of MS findings and can track changes in modification levels under different conditions. For functional studies, site-directed mutagenesis of identified modification sites followed by activity assays helps determine the physiological relevance of specific PTMs to RnfE function.

Advances in top-down proteomics, where intact proteins are analyzed without proteolytic digestion, are particularly valuable for mapping the combinatorial patterns of multiple PTMs that may occur simultaneously on RnfE. This approach preserves information about PTM crosstalk that is often lost in bottom-up proteomics approaches.

Lastly, structural analysis techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal how PTMs affect protein conformation and dynamics, providing insights into the structural consequences of modifications on this important electron transport protein.

How can contradictory findings on RnfE function be utilized to develop more robust experimental designs?

To develop more robust experiments, employ a multi-parameter design that intentionally varies conditions identified in the contradiction analysis. For example, if RnfE shows different electron transport activities across studies, systematically test the protein under varying pH levels, ion concentrations, membrane compositions, and redox states to map its complete functional profile. This approach transforms contradictions into comprehensive understanding of context-dependent function.

Statistical design of experiments (DOE) methodologies are particularly valuable in this context, allowing simultaneous evaluation of multiple factors that might influence RnfE function . Response surface methodology can identify optimal conditions as well as interaction effects between variables that might explain seemingly contradictory results from different laboratories.

Implementing standardized reporting of experimental conditions using minimum information guidelines ensures that critical parameters are consistently documented, facilitating more meaningful comparisons between studies. Additionally, collaborative cross-validation studies between laboratories reporting contradictory results can identify subtle methodological differences that explain discrepancies.

Finally, developing quantitative models that incorporate contextual factors identified through contradiction analysis can predict RnfE behavior under diverse conditions, transforming qualitative contradictions into a quantitative understanding of this complex membrane protein's function across different physiological states.

What are the emerging applications of recombinant RnfE in studying bacterial energy metabolism?

Recombinant RnfE protein is emerging as a valuable tool for investigating fundamental aspects of bacterial energy metabolism through several innovative applications. Researchers are using purified recombinant RnfE reconstituted into artificial membrane systems to study electron transport mechanisms under controlled conditions, allowing precise measurement of electron transfer rates and ion translocation efficiencies. These systems permit manipulation of lipid composition, redox partners, and electrochemical gradients to understand how environmental factors influence energy conservation in bacteria.

In synthetic biology applications, recombinant RnfE is being incorporated into engineered electron transport chains to enhance metabolic capabilities of industrial microorganisms. By optimizing the coupling between RnfE-mediated electron transport and biosynthetic pathways, researchers aim to improve production of biofuels and high-value biochemicals through more efficient energy utilization.

Structural biology approaches using recombinant RnfE are advancing our understanding of electron transport complex architecture. Cryo-electron microscopy studies of purified RnfE, alone or in complex with other Rnf components, are revealing the structural basis of ion translocation and electron transfer, with implications for understanding similar complexes across diverse bacterial species.

For antimicrobial development, recombinant RnfE serves as a target for high-throughput screening of compounds that disrupt bacterial energy metabolism. The ability to produce large quantities of purified protein facilitates structure-based drug design approaches targeting this essential component of bacterial physiology.

Finally, isotopically labeled recombinant RnfE enables advanced spectroscopic studies, including nuclear magnetic resonance (NMR) and electron paramagnetic resonance (EPR), providing unprecedented insights into the dynamic conformational changes that occur during the electron transport cycle and their coupling to energy conservation in bacterial systems.

What is the recommended protocol for optimizing expression and purification of RnfE for structural studies?

Optimizing expression and purification of RnfE for structural studies requires a systematic approach addressing the challenges associated with membrane proteins. Begin with vector design, incorporating a cleavable affinity tag (preferably His8 or His10 rather than standard His6) and testing multiple fusion partners such as maltose-binding protein (MBP) or SUMO to enhance solubility. Construct a panel of expression vectors with varying promoter strengths and ribosome binding sites to fine-tune expression levels, as overexpression often leads to misfolding of membrane proteins .

For expression, evaluate specialized E. coli strains designed for membrane proteins, including C41(DE3), C43(DE3), and Lemo21(DE3), which better tolerate membrane protein expression. Implement a high-throughput screening approach varying induction parameters (temperature: 16-30°C; inducer concentration: 0.1-1.0 mM IPTG; induction time: 4-24 hours) and media compositions (including supplementation with specific lipids and trace elements). Monitor expression using in-gel fluorescence with a GFP fusion construct to rapidly identify optimal conditions.

The purification protocol should begin with efficient membrane isolation through differential centrifugation followed by solubilization screening. Test a matrix of detergents including mild options (DDM, LMNG, GDN) at various concentrations and detergent:protein ratios. Purification typically employs a three-step chromatography strategy: IMAC using the His-tag, followed by ion exchange chromatography, and finally size exclusion chromatography to isolate monodisperse protein .

For structural studies, assess protein stability and homogeneity using techniques such as thermostability assays, negative-stain electron microscopy, and dynamic light scattering. Further optimization may include amphipol exchange or reconstitution into nanodiscs or liposomes to provide a more native-like environment. Throughout the process, employ small-scale parallel processing to efficiently identify optimal conditions before scaling up for structural biology applications.

How can isothermal titration calorimetry (ITC) be applied to study RnfE interactions with electron donors/acceptors?

Isothermal titration calorimetry (ITC) provides a powerful approach for quantitatively characterizing the thermodynamic parameters of RnfE interactions with electron donors and acceptors. For membrane proteins like RnfE, several modifications to standard ITC protocols are necessary. Begin by purifying RnfE to >95% homogeneity and stabilizing it in a suitable detergent system (typically DDM or LMNG at concentrations slightly above their critical micelle concentration) or reconstituting it into nanodiscs to provide a membrane-like environment.

The experimental setup should include RnfE at 10-50 μM in the sample cell, with the electron donor or acceptor (such as ferredoxin, NAD+/NADH, or artificial electron carriers) as the titrant at 10-fold higher concentration. All buffers must be precisely matched and thoroughly degassed to minimize background heat signals. For redox-active components, careful control of the oxidation state is critical; this can be achieved by performing experiments under anaerobic conditions with addition of redox buffers at defined potentials.

The following table outlines typical experimental parameters for ITC analysis of RnfE interactions:

ParameterRecommended SettingNotes
Temperature25°CTemperature dependence studies (15-37°C) provide entropy/enthalpy contributions
Stirring Speed750 rpmHigher speeds may be needed for viscous detergent solutions
Reference Power10 μcal/secAdjust based on anticipated heat changes
Initial Delay300 secAllow for thorough equilibration
Injection Volume2-3 μL first injection, 10 μL subsequentFirst injection typically discarded due to diffusion effects
Injection Duration20 secSlower injection for viscous solutions
Spacing Between Injections180-300 secLonger times ensure complete return to baseline
Total Injections20-25Sufficient to reach saturation

Data analysis should account for the heat of dilution of both the protein and ligand by performing appropriate control experiments. For complex binding mechanisms involving multiple sites or coupled processes, global fitting to appropriate thermodynamic models is essential. The resulting thermodynamic parameters (ΔG, ΔH, ΔS, Kd) provide valuable insights into the energetics of electron transfer processes mediated by RnfE.

What approaches can resolve contradictory data between in vitro and in vivo studies of RnfE function?

Resolving contradictions between in vitro and in vivo studies of RnfE function requires a systematic bridging approach that progressively increases experimental complexity while maintaining analytical rigor. Begin by identifying specific discrepancies through comprehensive literature analysis and creating a detailed comparison table documenting methodological differences, cellular contexts, and functional parameters measured .

To address these contradictions, implement a tiered experimental strategy that spans the complexity gap. First, develop more physiologically relevant in vitro systems by reconstituting purified RnfE into liposomes with defined lipid compositions matching the bacterial membrane, including specific lipids that may affect function. Include additional electron transport chain components in these reconstituted systems to better mimic the cellular environment.

Concurrently, develop simplified in vivo systems using genetic approaches. Create Salmonella strains with controlled expression of RnfE variants and minimal backgrounds where competing pathways are deleted. These strains allow more direct correlation with in vitro measurements while maintaining cellular context. Employ real-time measurement techniques such as membrane-permeable redox-sensitive fluorescent probes to monitor electron transport in living cells under conditions matching in vitro experiments.

Targeted mutagenesis provides another powerful approach – identifying residues that show different functional impacts in vitro versus in vivo can reveal context-dependent regulation or interaction partners. Systematic characterization of these mutations across both systems helps identify factors responsible for functional differences.

Finally, develop mathematical models incorporating data from both approaches, iteratively refining parameters to reconcile contradictions. This computational integration can reveal emergent properties that explain seemingly contradictory observations and generate testable hypotheses about regulatory mechanisms that differentially affect RnfE function in isolated versus cellular contexts.

What are the recommended controls for studies analyzing RnfE contribution to bacterial virulence?

Robust experimental design for analyzing RnfE contribution to bacterial virulence requires comprehensive controls addressing genetic, physiological, and methodological variables. From a genetic perspective, precise deletion mutants (ΔrnfE) should be complemented with both wild-type RnfE and site-directed mutants affecting specific functional domains to distinguish between structural and catalytic contributions to virulence . All genetic manipulations should be verified by whole genome sequencing to confirm the absence of secondary mutations that might confound interpretation.

Growth rate controls are essential, as defects in electron transport may cause general growth impairment rather than specific virulence attenuation. Compare growth curves in multiple media types, including minimal media and those mimicking host environments, using both optical density measurements and viable count determinations to accurately assess fitness costs of RnfE manipulation.

The following control panel is recommended for virulence studies:

Control TypeDescriptionPurpose
Genetic ControlsWild-type parent strain
ΔrnfE mutant
Complemented ΔrnfE::rnfE
Point mutants affecting key residues
Establish baseline virulence
Assess complete loss of function
Confirm phenotype is due to rnfE deletion
Distinguish functional domains
Physiological ControlsGrowth rates in multiple media
ATP/NAD+/NADH levels
Membrane potential measurements
Stress response activation
Control for general fitness effects
Assess energy metabolism status
Measure electron transport function
Identify indirect effects
Host Response ControlsInnate immune activation assays
Inflammatory marker measurements
Host cell invasion with metabolically equivalent strains
Control for differential immune recognition
Assess contribution to inflammation
Normalize for growth/metabolic differences
Methodological ControlsMultiple infection routes
Range of infectious doses
Time-course analyses
Ex vivo survival in relevant host fluids
Control for tissue-specific effects
Identify threshold-dependent phenotypes
Distinguish between infection stages
Assess environmental survival factors

For in vivo experiments, competition assays where wild-type and ΔrnfE strains are co-administered provide the most sensitive measure of virulence attenuation while controlling for host-to-host variation. Finally, all virulence studies should include complementation with heterologous electron transport systems to distinguish between specific RnfE functions and general effects of disrupted electron transport on bacterial physiological status during infection .

What are the current research gaps in understanding RnfE function and applications?

Despite significant advances in characterizing the Salmonella heidelberg Electron transport complex protein RnfE, several critical knowledge gaps remain that limit our comprehensive understanding of its function and potential applications. At the molecular level, the precise mechanism of electron transfer through the RnfE subunit and its coordination with other components of the Rnf complex remains poorly defined. High-resolution structural data, particularly showing dynamic conformational changes during the electron transport cycle, would significantly advance our mechanistic understanding.

The regulatory networks controlling RnfE expression under different environmental conditions and stress responses represent another substantial gap. While basic expression systems have been established, the factors influencing RnfE expression during host colonization, environmental persistence, and in response to antimicrobial pressure remain largely unexplored. This understanding is crucial for developing targeted interventions based on RnfE function.

From an immunological perspective, the antigenic properties of RnfE and its potential as a vaccine component have not been fully characterized. While recombinant Salmonella vaccines have shown promise, the specific contribution of RnfE to immune recognition and protection requires further investigation . Additionally, the cross-protection potential against heterologous bacterial species sharing homologous electron transport components represents an unexplored opportunity.

Methodologically, standardized protocols for functional assays of RnfE activity in both in vitro reconstituted systems and within living cells would facilitate more reliable comparisons between studies. Current contradictions in the literature often stem from methodological variations that complicate interpretation of results .

Finally, the potential for targeting RnfE in antimicrobial development remains largely theoretical. Structure-activity relationship studies identifying compounds that specifically inhibit RnfE function, along with validation of their effects on bacterial viability and virulence, would open new avenues for therapeutic development against Salmonella and potentially other pathogens utilizing similar electron transport systems.

How might advances in structural biology techniques impact future research on RnfE and related electron transport proteins?

Recent breakthroughs in structural biology methodologies are poised to transform our understanding of RnfE and related electron transport proteins through unprecedented insights into their molecular architecture and dynamic behavior. Cryo-electron microscopy (cryo-EM) advances, particularly the development of improved direct electron detectors and image processing algorithms, now enable determination of near-atomic resolution structures of membrane protein complexes without crystallization. This capability will likely reveal the complete structure of the Rnf complex, including the precise arrangement of RnfE within the assembly and its interactions with other subunits.

Time-resolved cryo-EM techniques are emerging that can capture different conformational states of the protein during the electron transport cycle, potentially visualizing the structural changes associated with energy transduction. Similarly, advances in electron paramagnetic resonance (EPR) spectroscopy, particularly double electron-electron resonance (DEER) techniques, allow measurement of distances between specific sites in the protein, providing valuable information about conformational dynamics during function.

Integrative structural biology approaches combining multiple techniques (X-ray crystallography, cryo-EM, NMR, mass spectrometry) will provide complementary data that, when computationally integrated, can generate comprehensive structural models of RnfE in different functional states. These models will inform hypothesis-driven mutagenesis studies to validate mechanistic proposals.

Computational advances in molecular dynamics simulations now permit modeling of large membrane protein complexes embedded in realistic lipid bilayers over physiologically relevant timescales. When applied to RnfE, these simulations could reveal lipid-protein interactions critical for function and predict the energetics of electron and ion transport processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.