Recombinant Salmonella heidelberg Fumarate reductase subunit C (frdC)

What is the basic structure and function of Salmonella heidelberg Fumarate reductase subunit C?

Salmonella heidelberg Fumarate reductase subunit C (frdC) is a 15 kDa hydrophobic membrane protein comprising 131 amino acids. It functions as the membrane anchor component of the fumarate reductase complex. The amino acid sequence (MTTKKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGFVGFLQNPVVVILNLITLAAALLHTKTWFELTPKAANIIVKDEKMGPEPIIKGLWVVTAVVTVVILYVALFW) reveals its hydrophobic nature, consistent with its membrane-embedded role .

In functional terms, frdC serves as the membrane anchor and diheme cytochrome b within the complete fumarate reductase enzyme complex. This complex typically consists of three subunits: FrdC (membrane anchor), FrdA (flavoprotein catalytic component), and FrdB (iron-sulfur protein) . The complex plays a crucial role in anaerobic respiration by catalyzing the reduction of fumarate to succinate, enabling the organism to use fumarate as a terminal electron acceptor when oxygen is unavailable.

How does the gene organization of the frd operon in Salmonella heidelberg compare to other bacterial species?

The gene organization of the frd operon in Salmonella heidelberg follows a pattern comparable to other bacteria in the Enterobacteriaceae family. The frd operon consists of frdC, frdA, and frdB genes arranged sequentially, similar to the arrangement observed in Wolinella succinogenes and Helicobacter pylori . This conservation suggests functional significance in the coordinate expression of these genes.

The locus designation for frdC in Salmonella heidelberg (strain SL476) is SeHA_C4759 . A comparative genomic analysis reveals that while the basic operon structure is conserved across many bacteria, there are species-specific variations that may reflect adaptations to different ecological niches and metabolic requirements. Unlike some organisms that possess both fumarate reductase (Frd) and succinate dehydrogenase (Sdh) complexes, some bacteria appear to have a dual-functioning enzyme that catalyzes reactions in both directions depending on cellular redox conditions .

What are the optimal conditions for storage and handling of recombinant frdC protein to maintain stability and activity?

Recombinant Salmonella heidelberg frdC requires specific storage and handling conditions to preserve its structural integrity and functional properties. Based on established protocols, the following guidelines are recommended:

Storage Conditions:

• Store at -20°C for routine use

• For extended storage, maintain at -80°C

• Use a storage buffer containing Tris-based components supplemented with 50% glycerol, optimized for protein stability

Handling Recommendations:

• Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

• When working with the protein, prepare small working aliquots and store at 4°C for up to one week

• For experiments requiring longer incubation periods, maintain the protein in anaerobic conditions when possible to prevent oxidative damage to the heme groups

These guidelines ensure that the recombinant protein maintains its native conformation and functional properties throughout experimental procedures.

What expression systems and purification strategies are most effective for producing functional recombinant frdC?

Production of functional recombinant frdC requires careful consideration of expression systems and purification strategies due to its membrane-associated nature. The following approaches have proven effective:

Expression Systems:

• Heterologous expression in E. coli using specialized vectors containing fusion partners like maltose-binding protein has shown success for similar membrane proteins

• The BL21(DE3) strain with pET-based vectors can provide high-yield expression when the growth temperature is reduced to 18-25°C after induction

• Membrane protein-specific expression hosts such as C41(DE3) or C43(DE3) may improve proper folding and membrane insertion

Purification Strategy:

• Membrane fraction isolation via differential centrifugation

• Solubilization using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or digitonin)

• Immobilized metal affinity chromatography (IMAC) with careful optimization of imidazole gradients

• Size exclusion chromatography as a polishing step

For functional studies, co-expression with FrdA and FrdB subunits may be necessary to obtain the fully assembled complex with proper enzymatic activity.

How can site-directed mutagenesis of frdC be utilized to investigate electron transport mechanisms in Salmonella anaerobic respiration?

Site-directed mutagenesis of frdC provides a powerful approach to dissect the electron transport mechanisms in Salmonella anaerobic respiration. The methodology should focus on key residues within the protein:

Target Residues for Mutagenesis:

• Conserved histidine residues that coordinate heme groups

• Hydrophobic residues that anchor the protein in the membrane

• Amino acids at the interface with FrdA and FrdB that mediate complex assembly

Experimental Approach:

• Generate point mutations using overlap extension PCR or commercial mutagenesis kits

• Express mutant proteins alongside wild-type FrdA and FrdB

• Assess complex assembly using blue native PAGE

• Measure electron transfer rates using spectrophotometric assays with benzyl viologen as an artificial electron donor

• Analyze fumarate reduction activity under various redox conditions

A systematic analysis comparing activity of wild-type and mutant complexes can reveal the contribution of specific residues to electron transport pathways, providing insights into the bioenergetics of anaerobic respiration in Salmonella.

What techniques can be employed to study the interaction between frdC and quinones in the membrane environment?

Investigating the interaction between frdC and quinones requires specialized techniques that can capture membrane protein-lipid interactions. The following methodologies are particularly valuable:

Biophysical Approaches:

• Reconstitution Studies: Incorporate purified frdC into proteoliposomes with defined lipid composition and quinone content

• Electron Paramagnetic Resonance (EPR): Use spin-labeled quinones to probe binding sites and conformational changes

• Surface Plasmon Resonance (SPR): Immobilize frdC on sensor chips and measure binding kinetics with various quinone derivatives

Biochemical Methods:

• Photoaffinity Labeling: Utilize quinone analogs with photoactivatable groups to covalently trap interaction sites

• Competitive Binding Assays: Measure displacement of labeled quinones by potential inhibitors

• Activity Assays: Monitor enzyme activity with different quinone substrates using spectrophotometric methods similar to those employing benzyl viologen

These techniques provide complementary information about the structural determinants of quinone binding, the kinetics of interaction, and their functional consequences for fumarate reduction activity.

How does the function of frdC in Salmonella heidelberg compare to homologous proteins in other enteric pathogens?

Fumarate reductase subunit C (frdC) in Salmonella heidelberg shares significant structural and functional similarities with homologous proteins in other enteric pathogens, but with distinct characteristics that reflect evolutionary adaptations:

The comparative analysis reveals that while the core function of electron transport is conserved, subtle differences exist in regulatory mechanisms, substrate affinities, and electron donor preferences. These differences likely reflect adaptations to specific host environments and metabolic requirements. The dual functionality observed in C. jejuni's enzyme, serving as both fumarate reductase and succinate dehydrogenase, represents an interesting evolutionary adaptation that might provide metabolic flexibility .

What roles does frdC play in Salmonella heidelberg pathogenesis and antimicrobial resistance?

The contribution of frdC to Salmonella heidelberg pathogenesis and antimicrobial resistance involves multiple mechanisms:

Pathogenesis Contributions:

• Anaerobic Adaptation: By enabling fumarate respiration, frdC allows Salmonella to colonize anaerobic microenvironments within the host

• Metabolic Flexibility: The ability to use alternative electron acceptors provides a competitive advantage in the intestinal environment

• Persistence: Anaerobic respiration supported by frdC may contribute to long-term persistence in host tissues

Antimicrobial Resistance Connections:
Although frdC itself is not directly implicated in antimicrobial resistance, recent research indicates potential indirect connections. Studies of multidrug-resistant Salmonella Heidelberg isolates have shown genomic alterations associated with the acquisition of resistance plasmids . While the direct relationship between frdC and these resistance mechanisms requires further investigation, the metabolic adaptability conferred by functional fumarate reductase may contribute to bacterial fitness during antimicrobial stress.

Research examining isolates from poultry environments found that 36% of S. Heidelberg isolates from fresh litter acquired multidrug resistance (to gentamicin, tetracycline, and streptomycin), compared to only 0.7% of isolates from reused litter . This suggests that environmental conditions influence resistance acquisition, potentially through mechanisms that may interact with basic metabolic functions like those involving the fumarate reductase complex.

What are common challenges in assaying fumarate reductase activity in recombinant systems, and how can they be addressed?

Assaying fumarate reductase activity in recombinant systems presents several technical challenges. Here are the most common issues and recommended solutions:

Challenge 1: Oxygen Sensitivity

• Problem: Fumarate reductase activity is inhibited by oxygen, leading to inconsistent results

• Solution: Conduct assays in anaerobic chambers or cuvettes with stoppers; flush systems with N₂ gas; include oxygen-scavenging enzyme systems (glucose oxidase/catalase)

Challenge 2: Electron Donor Selectivity

• Problem: Different electron donors yield varying activity profiles

• Solution: Use standardized electron donors like benzyl viologen; maintain consistent reduction state (monitor absorbance at 585 nm to achieve half-reduction); include controls with known activity

Challenge 3: Membrane Protein Solubility

• Problem: Poor solubility of frdC impacts complex assembly and activity

• Solution: Optimize detergent type and concentration; consider native nanodiscs or amphipols for membrane protein stabilization

Challenge 4: Complex Assembly

• Problem: Incomplete assembly of the FrdCAB complex

• Solution: Co-express all three subunits; validate complex formation via size exclusion chromatography or blue native PAGE before activity measurements

By systematically addressing these challenges, researchers can obtain reliable and reproducible measurements of fumarate reductase activity.

How can structural biology approaches be applied to understand frdC function despite challenges in membrane protein crystallization?

Cryo-Electron Microscopy (Cryo-EM):

• Advantages: Does not require crystallization; captures protein in near-native lipid environment

• Approach: Reconstitute purified frdC (ideally with FrdA and FrdB) in nanodiscs or amphipols

• Analysis: Single-particle analysis to generate 3D reconstructions

• Resolution: Recent advances enable near-atomic resolution for membrane proteins of similar size

Integrative Structural Biology:

• Combine multiple experimental approaches:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions

  • Cross-linking mass spectrometry (XL-MS) to identify spatial proximity between residues

  • Molecular dynamics simulations to model membrane interactions

  • Evolutionary coupling analysis to identify co-evolving residues

NMR Spectroscopy:

• Solution NMR of isolated domains

• Solid-state NMR of reconstituted complexes in lipid bilayers

• Specific isotope labeling strategies to focus on key functional regions

By integrating these complementary approaches, researchers can develop detailed structural models of frdC and its interactions within the fumarate reductase complex, even in the absence of crystal structures.

What emerging technologies could advance our understanding of frdC's role in bacterial metabolism and pathogenesis?

Several cutting-edge technologies show promise for deepening our understanding of frdC's role:

CRISPR Interference (CRISPRi) and CRISPR Activation (CRISPRa):

• Enable precise temporal control of frdC expression

• Allow titration of expression levels to determine threshold requirements

• Facilitate study of frdC essentiality under various environmental conditions

In vivo Metabolic Sensors:

• Develop fluorescent biosensors to track fumarate/succinate ratios in real-time

• Monitor redox changes associated with fumarate reductase activity

• Map metabolic fluxes during host infection

Single-Cell Technologies:

• Apply transcriptomics and proteomics at single-cell resolution

• Identify heterogeneity in frdC expression within bacterial populations

• Correlate expression profiles with metabolic states and virulence

Microfluidic Infection Models:

• Create controlled oxygen gradients to simulate host environments

• Track bacterial behavior in real-time during shifts between aerobic and anaerobic conditions

• Assess the impact of frdC function on adaptation to changing environments

These technologies, applied individually or in combination, could provide unprecedented insights into the dynamic role of frdC in bacterial metabolism and pathogenesis.

How might frdC be exploited as a potential drug target for novel antimicrobial development against Salmonella infections?

The essential role of frdC in anaerobic respiration presents opportunities for targeted antimicrobial development:

Target Validation Approach:

• Confirm essentiality under in vivo conditions using conditional knockdown systems

• Evaluate growth attenuation in animal infection models

• Assess compensation mechanisms through alternative metabolic pathways

Drug Discovery Strategies:

• Structure-Based Design:

  • Target quinone-binding site with competitive inhibitors

  • Design molecules that disrupt complex assembly between frdC and other subunits

  • Develop allosteric modulators that lock the protein in an inactive conformation

• High-Throughput Screening:

  • Develop whole-cell assays under anaerobic conditions

  • Screen for compounds that specifically inhibit growth on fumarate-containing media

  • Employ counterscreens to eliminate generally toxic compounds

• Combination Approaches:

  • Identify synergistic effects between frdC inhibitors and existing antibiotics

  • Target multiple components of anaerobic respiration simultaneously

The specificity of fumarate reductase to anaerobic conditions potentially offers a selective advantage: drugs targeting this complex might specifically affect bacteria in the anaerobic environment of infection sites while sparing aerobic commensal flora, potentially reducing disruption to the host microbiome.