Recombinant Salmonella heidelberg Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
frdD; SeHA_C4758; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Fumarate Reductase Subunit D (FrdD) in Salmonella Heidelberg?

FrdD functions as one of the membrane anchor subunits in the fumarate reductase enzyme complex. In typical bacterial fumarate reductases, the enzyme consists of four subunits: FrdA (catalytic subunit), FrdB (iron-sulfur subunit), and FrdC/FrdD (membrane anchor subunits). The FrdD subunit, together with FrdC, anchors the catalytic components to the membrane and participates in electron transfer, accepting electrons from quinols and transferring them to FrdB, which subsequently transfers them to FrdA where fumarate is reduced to succinate . This membrane-bound respiratory enzyme is particularly important during anaerobic growth when fumarate serves as a terminal electron acceptor. In Salmonella Heidelberg, this enzyme likely contributes to metabolic adaptability in oxygen-limited environments such as the intestinal tract.

What methods are recommended for expressing recombinant FrdD from Salmonella Heidelberg?

When expressing recombinant FrdD, researchers should consider these methodological approaches:

  • Expression system selection: E. coli expression systems are commonly used, but obtaining functional membrane proteins often requires specialized strains optimized for membrane protein expression.

  • Construct design: The hydrophobic nature of FrdD necessitates careful construct design, potentially including:

    • Fusion tags for detection and purification (His-tag, FLAG-tag)

    • Solubility-enhancing partners for improved expression

    • Signal sequences to ensure proper membrane targeting

  • Induction conditions: Lowered induction temperatures (16-25°C) and reduced inducer concentrations often improve membrane protein folding and reduce formation of inclusion bodies.

  • Extraction protocol: Membrane proteins require specialized extraction methods using appropriate detergents (DDM, LDAO, or Triton X-100) to solubilize the protein while maintaining its native conformation.

  • Validation: Functional assays measuring electron transfer capability or complex assembly with other Frd subunits should be performed to confirm proper folding and activity .

How does antimicrobial resistance in Salmonella Heidelberg correlate with fumarate reductase activity?

The correlation between antimicrobial resistance and fumarate reductase activity in Salmonella Heidelberg represents a complex research area requiring multifaceted experimental approaches. Multidrug-resistant (MDR) S. Heidelberg strains have demonstrated resistance to first-line antibiotics including ampicillin, ceftriaxone, and ciprofloxacin . Research methodologies to investigate potential connections include:

  • Comparative genomics and transcriptomics: Compare frd operon expression levels between antimicrobial-resistant and susceptible strains under various growth conditions. RNA-seq analysis should include growth under both aerobic and anaerobic conditions to capture differential expression patterns.

  • Knockout studies: Generate frdD deletion mutants in resistant and susceptible backgrounds to assess changes in antimicrobial minimum inhibitory concentrations (MICs).

  • Metabolomic analysis: Measure TCA cycle intermediate concentrations in resistant vs. susceptible strains to identify metabolic adaptations that might link respiratory activity to resistance mechanisms.

  • Electron transport chain analysis: Investigate whether alterations in membrane potential due to FrdD function affect antimicrobial uptake or efflux pump activity.

What are the experimental challenges in studying the role of recombinant FrdD in Salmonella Heidelberg virulence?

Investigating FrdD's contribution to S. Heidelberg virulence presents several methodological challenges:

  • Membrane protein expression difficulties: FrdD's hydrophobic nature complicates recombinant expression and purification. Researchers should employ specialized membrane protein expression systems with controlled expression rates and appropriate detergent selection.

  • Functional redundancy: Salmonella possesses multiple anaerobic respiratory pathways that may compensate for FrdD deficiencies. Experimental designs should include multiple deletion backgrounds to address redundant systems.

  • Growth condition variables: FRD activity is primarily relevant under anaerobic conditions. Experiments must accurately simulate the microaerobic/anaerobic environments encountered during infection while maintaining culture consistency.

  • In vivo relevance: The true contribution of FrdD to virulence may only be apparent in animal infection models. Cell culture models may not fully recapitulate the oxygen limitation encountered in vivo. Considering that S. Heidelberg has demonstrated zoonotic transmission from calves to humans , both bovine and human cell models should be evaluated.

  • Experimental readouts: Determining appropriate virulence parameters to measure (invasion efficiency, intracellular replication, resistance to host defenses) requires careful experimental design with appropriate controls.

A comprehensive approach would combine in vitro biochemical characterization with ex vivo and in vivo infection models to establish physiological relevance.

How can researchers effectively differentiate between the metabolic and virulence contributions of FrdD in Salmonella Heidelberg?

Distinguishing between FrdD's metabolic and virulence functions requires sophisticated experimental approaches:

What techniques are most effective for studying interactions between FrdD and other fumarate reductase subunits?

Investigating subunit interactions within the fumarate reductase complex requires specialized approaches for membrane protein complexes:

  • Cryo-electron microscopy (cryo-EM): This has become the gold standard for membrane protein complex structural analysis, offering near-atomic resolution without crystallization. Sample preparation should focus on detergent selection and concentration optimization to maintain the intact complex.

  • Chemical cross-linking coupled with mass spectrometry (XL-MS): This technique captures transient interactions by covalently linking neighboring proteins. For FrdD interactions:

    • Use membrane-permeable cross-linkers like DSS or BS3

    • Optimize cross-linker concentration and reaction time

    • Employ specialized digestion protocols for hydrophobic proteins

    • Analyze results with dedicated XL-MS software (e.g., xQuest, pLink)

  • Förster Resonance Energy Transfer (FRET): By tagging FrdD and potential interaction partners with fluorescent proteins or dyes, researchers can monitor protein interactions in real-time in live bacteria.

  • Reconstitution assays: Purified recombinant components can be combined in artificial membrane systems (liposomes or nanodiscs) to assess complex formation and function in a defined environment.

  • Genetic complementation studies: Expressing recombinant variants in knockout strains allows assessment of which protein domains are essential for functional complex assembly.

The intact fumarate reductase complex is critical for enzymatic activity, as demonstrated by activity measurements of the purified enzyme , making the study of subunit interactions particularly important.

What structural characteristics differentiate FrdD in Salmonella Heidelberg from other bacterial species?

Current structural data specifically for S. Heidelberg FrdD is limited, but comparative analysis with related bacteria suggests several important considerations:

Table 1: Comparative Analysis of FrdD Structural Features

FeatureE. coli FrdDPredicted S. Heidelberg FrdDFunctional Significance
Transmembrane helices33 (predicted)Membrane anchoring
Length (amino acids)119~120 (estimated)Compact structure typical of anchor subunits
Conserved quinone binding residuesPresentLikely present (requires verification)Critical for electron transfer
Post-translational modificationsNone reportedUnknownPotential regulatory mechanism
Interacting domainsInterfaces with FrdCPredicted interface with FrdCEssential for complex assembly

For detailed structural analysis, researchers should:

  • Perform homology modeling based on E. coli or other closely related structures

  • Validate predictions with site-directed mutagenesis of key residues

  • Consider species-specific adaptations that might relate to host environment

  • Examine potential unique post-translational modifications

The structure-function relationship of FrdD is particularly relevant when designing inhibitors or when investigating how structural features might contribute to virulence or antimicrobial resistance phenotypes observed in S. Heidelberg outbreaks .

How can recombinant FrdD be utilized in Salmonella Heidelberg vaccine development strategies?

Utilizing recombinant FrdD in S. Heidelberg vaccine development presents several strategic approaches:

  • Subunit vaccine development: Recombinant FrdD could be combined with other immunogenic Salmonella proteins. Research suggests that surface-exposed proteins like FliD and FlgK generate stronger immune responses in chickens compared to other proteins like FimA and FimW . When incorporating FrdD, researchers should:

    • Assess FrdD immunogenicity independently

    • Evaluate potential synergistic effects when combined with known immunogens

    • Optimize protein folding to present native epitopes

  • Live attenuated vector approach: The frdD gene could be modified to create attenuated strains with reduced virulence but maintained immunogenicity. This approach would leverage the established principle that recombinant attenuated Salmonella vaccines (RASV) can effectively deliver heterologous antigens .

  • Chimeric protein development: Creating fusion proteins of FrdD with highly immunogenic epitopes could enhance vaccine efficacy. Similar approaches with other Salmonella proteins have shown promise, such as the suggestion to create a chimeric protein of FimA and FimW to overcome limitations with individual proteins .

  • Immune response optimization: Careful analysis of humoral (IgG, IgA, IgM) and cell-mediated immune responses to recombinant FrdD is essential, as different Salmonella proteins elicit varying antibody profiles .

When developing FrdD-based vaccines, researchers must carefully balance attenuation with immunogenicity and consider the impact of recombinant modifications on protein expression and folding.

What are the critical considerations when designing experiments to evaluate recombinant FrdD as a potential vaccine antigen?

When evaluating recombinant FrdD as a vaccine antigen, researchers should consider these methodological aspects:

  • Expression system optimization:

    • Select appropriate vectors for stable expression

    • Determine optimal conditions for soluble protein production

    • Consider fusion tags that enhance immunogenicity without interfering with epitope presentation

  • Immunogenicity assessment protocol:

    • Measure multiple antibody isotypes (IgG, IgM, IgA) as different Salmonella proteins elicit varying responses

    • Evaluate both systemic and mucosal immunity

    • Assess cell-mediated immune responses (T-cell activation, cytokine profiles)

    • Include appropriate positive controls (known immunogenic proteins like FliD or FlgK)

  • Challenge study design:

    • Define clear protection endpoints

    • Use clinically relevant challenge strains

    • Include multiple routes of challenge (oral, systemic)

    • Measure bacterial burden in relevant tissues

    • Monitor shedding patterns and duration

  • Safety evaluation:

    • Test for persistence in vaccinated animals

    • Monitor for adverse reactions

    • Assess stability in immunocompromised models

    • Evaluate potential for reversion to virulence

Studies with other recombinant Salmonella proteins have shown that not all antigens generate protective responses despite being surface-exposed , highlighting the importance of rigorous experimental evaluation.

How might metabolomics approaches enhance our understanding of FrdD function in Salmonella Heidelberg pathogenesis?

Metabolomics offers powerful insights into the metabolic implications of FrdD function:

  • Comparative metabolic profiling: Analyze metabolite differences between wild-type and frdD mutants under various conditions. Key methodological considerations include:

    • Use both targeted and untargeted approaches

    • Focus on TCA cycle intermediates, particularly succinate and fumarate

    • Include redox cofactors (NAD+/NADH, quinones) in targeted analyses

    • Capture samples rapidly to prevent metabolic changes during processing

  • Flux analysis using stable isotope labeling: Tracking carbon flow through central metabolism can reveal how FrdD impacts metabolic pathway utilization.

    • 13C-labeled carbon sources allow mapping of metabolic flux

    • Time-course experiments capture dynamic metabolic adaptations

    • Computational modeling integrates data to predict metabolic network changes

  • In vivo metabolomics: Apply metabolomic approaches to infection models to determine how FrdD influences metabolism during host interaction.

    • Analyze infected host tissues for metabolic signatures

    • Compare metabolite profiles in different host niches

    • Correlate metabolic changes with virulence phenotypes

  • Integration with other omics data: Combine metabolomics with transcriptomics and proteomics for systems-level understanding of how FrdD impacts bacterial physiology and host interactions.

Current research has established the basic enzymatic function of fumarate reductase in converting fumarate to succinate using NADH or other electron donors , but the broader metabolic implications in pathogenesis remain largely unexplored.

What are the emerging technologies that could advance research on recombinant Salmonella Heidelberg FrdD?

Several cutting-edge technologies offer promising advances for FrdD research:

  • CRISPR-Cas genome editing:

    • Precise modification of frdD without polar effects on other genes

    • Creation of conditional expression systems for temporal control

    • Generation of tagged versions at the native locus for physiological expression levels

    • Engineering of specific amino acid substitutions to probe structure-function relationships

  • Single-cell techniques:

    • Microfluidic devices for tracking individual bacterial responses

    • Single-cell RNA-seq to capture population heterogeneity in frdD expression

    • Time-lapse microscopy with fluorescent reporters to monitor real-time expression

  • Advanced structural biology approaches:

    • AlphaFold and other AI-based structure prediction tools

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • Integrative structural biology combining multiple data types

  • Synthetic biology platforms:

    • Modular expression systems for testing different combinations of Frd subunits

    • Cell-free expression systems for difficult membrane proteins

    • Minimal genome approaches to reduce metabolic redundancy

  • Advanced animal models:

    • Humanized microbiome mouse models

    • Organoid systems that better recapitulate host environments

    • Defined microbiome models to study FrdD function in community contexts

These technologies could help address key knowledge gaps, particularly regarding how FrdD contributes to the multidrug resistance observed in outbreak strains of S. Heidelberg and potential applications in vaccine development strategies .

How does the research on Salmonella Heidelberg FrdD inform broader questions about metabolic adaptations in pathogenic bacteria?

Research on S. Heidelberg FrdD offers valuable insights into fundamental questions about bacterial pathogenesis:

  • Metabolic flexibility during infection: FrdD's role in anaerobic respiration illustrates how metabolic adaptability contributes to pathogen success in changing host environments. This research connects to broader questions about:

    • How metabolic networks reconfigure during host colonization

    • The relationship between central metabolism and virulence gene expression

    • Metabolic competition between pathogens and the host microbiota

  • Host-pathogen metabolic interactions: FrdD research provides a model for studying how bacterial metabolic activities influence host responses:

    • Production of metabolites that may function as signaling molecules

    • Alteration of local microenvironments to favor pathogen growth

    • Metabolic cross-feeding relationships within infection sites

  • Evolutionary perspectives: Comparative analysis of FrdD across bacterial species offers insights into metabolic adaptation during speciation and host adaptation:

    • Conservation of core metabolic functions across divergent pathogens

    • Host-specific adaptations in metabolic enzyme structure and regulation

    • Horizontal gene transfer of metabolic functions

  • Antibiotic resistance connections: As multidrug-resistant S. Heidelberg presents significant public health concerns , understanding metabolic adaptations may reveal:

    • Metabolic states that enhance antibiotic tolerance

    • Energy requirements for resistance mechanism expression

    • Novel metabolic targets for antibiotic development

Understanding FrdD in S. Heidelberg contributes to the broader research field exploring how metabolic versatility supports pathogen success across diverse host environments and in the face of antimicrobial challenges.

What are the recommended protocols for purifying recombinant Salmonella Heidelberg FrdD for structural studies?

Purifying membrane proteins like FrdD presents unique challenges requiring specialized protocols:

  • Optimized expression system:

    • Use C41(DE3) or C43(DE3) E. coli strains specifically designed for membrane protein expression

    • Consider codon optimization for S. Heidelberg sequences

    • Employ low-copy number vectors with tunable promoters

    • Express at reduced temperatures (16-20°C) to improve folding

  • Solubilization strategy:

    • Screen multiple detergents (DDM, LDAO, Triton X-100) for optimal extraction

    • Test detergent concentration gradients to identify minimal effective concentration

    • Consider newer amphipols or nanodiscs for maintaining native structure

  • Purification workflow:

    • Initial purification via affinity chromatography (IMAC for His-tagged constructs)

    • Secondary purification by size exclusion chromatography

    • Optional ion exchange step for additional purity

    • Maintain detergent above critical micelle concentration throughout

  • Quality control assessments:

    • SDS-PAGE with membrane protein-specific staining techniques

    • Western blotting for identity confirmation

    • Circular dichroism to verify secondary structure content

    • Dynamic light scattering for homogeneity analysis

  • Functional validation:

    • Reconstitution assays with other FRD subunits

    • Activity measurements using enzymatic assays similar to those described for measuring the decrease in NADH and production of succinate

Researchers have successfully purified related membrane proteins by measuring enzyme activity at various stages to ensure the protein remains functional throughout the purification process .

What experimental controls are essential when studying the impact of FrdD mutations on Salmonella Heidelberg virulence?

Rigorous experimental controls are critical for meaningful interpretation of FrdD mutation studies:

  • Genetic complementation controls:

    • Wild-type complementation in trans

    • Site-directed mutant complementation

    • Empty vector control

    • Chromosomal restoration of wild-type sequence

    • All constructed on identical genetic backgrounds

  • Growth condition controls:

    • Aerobic vs. anaerobic growth curves to differentiate respiration-specific effects

    • Growth in various carbon sources to identify metabolic dependencies

    • Stress response profiling (pH, oxidative stress, etc.)

    • Growth in media mimicking host environments

  • Expression verification controls:

    • qRT-PCR for transcriptional analysis

    • Western blot for protein expression levels

    • Membrane fraction analysis for proper localization

    • Complex assembly verification

  • Phenotypic characterization controls:

    • Motility assays

    • Biofilm formation assessment

    • Stress resistance profiling

    • Antibiotic susceptibility testing across multiple classes

  • Virulence model controls:

    • Multiple infection routes

    • Dose-response studies

    • Timing analysis (early vs. late infection stages)

    • Host factor variation (different genetic backgrounds, ages)

    • Competition assays between mutant and wild-type strains

Research on multidrug-resistant S. Heidelberg has demonstrated increased virulence associated with certain resistance profiles , making careful control design essential for distinguishing direct FrdD effects from broader physiological changes.

How can findings on Salmonella Heidelberg FrdD be integrated with research on diffusible signal factors to develop novel antivirulence strategies?

Integration of FrdD research with diffusible signal factor (DSF) studies presents promising opportunities:

  • Metabolic crosstalk investigation:

    • Determine if DSFs like cis-2-hexadecenoic acid (c2-HDA) affect FrdD expression or function

    • Assess whether fumarate reductase activity influences DSF production or detection

    • Examine potential relationship between anaerobic respiration and quorum-sensing circuits

  • Combined intervention strategies:

    • Develop dual-targeting approaches using DSF production and FrdD inhibition

    • Create engineered probiotics expressing both DSFs and FrdD-targeting molecules

    • Design sequential treatment strategies targeting different virulence phases

  • Experimental approaches:

    • Co-culture systems with DSF-producing recombinant bacteria and S. Heidelberg

    • Metabolomic analysis of DSF-treated S. Heidelberg with focus on TCA cycle metabolites

    • Transcriptional profiling of frd operon response to DSF exposure

    • Animal infection models testing combined interventions

  • Mechanistic investigations:

    • Characterize molecular interactions between DSFs and respiratory components

    • Identify regulatory networks connecting quorum sensing and metabolic adaptation

    • Determine if metabolic state influences susceptibility to DSF-mediated virulence inhibition

Research has demonstrated that DSFs like c2-HDA can signal repression of Salmonella tissue invasion , while FrdD functions in anaerobic respiration . Investigating potential connections between these systems could reveal how bacteria integrate environmental chemical sensing with metabolic adaptation during infection.

What research gaps remain in understanding the relationship between FrdD function and Salmonella Heidelberg pathogenicity in different host species?

Several critical knowledge gaps exist regarding FrdD's role in S. Heidelberg pathogenicity across hosts:

  • Host-specific metabolic adaptations:

    • Comparative analysis of frdD expression during infection of different hosts (humans, cattle, poultry)

    • Determination of whether host-specific factors regulate fumarate reductase activity

    • Assessment of metabolite availability in different host niches and implications for FrdD importance

  • Immune response interactions:

    • Investigation of whether FrdD-dependent metabolites modulate host immunity

    • Characterization of potential FrdD epitopes recognized by different host immune systems

    • Evaluation of whether metabolic state influences susceptibility to host defense mechanisms

  • Methodological approaches for cross-species studies:

    • Development of standardized infection models across multiple host species

    • Establishment of tissue culture systems representing different host environments

    • Creation of reporter systems to monitor frdD expression in vivo

  • Zoonotic transmission implications:

    • Assessment of whether FrdD function contributes to successful cross-species transmission

    • Investigation of metabolic adaptations during host switching events

    • Determination if FrdD inhibition could reduce zoonotic transmission potential

The zoonotic nature of S. Heidelberg infections, with documented transmission from calves to humans , highlights the importance of understanding how metabolic systems like fumarate reductase may contribute to pathogen adaptability across different host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.